KEGG   Verticillium alfalfae: VDBG_03406Help
Entry
VDBG_03406        CDS       T02227                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
val  Verticillium alfalfae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_03406
Enzymes [BR:val01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VDBG_03406
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDBG_03406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 689 aa AA seqDB search
MAAVVEQSANSLAPQAAAAGAATGNRTDGTGVIQLDPWLEPFEDAFKRRYAKAQDWLTKL
DKTEGGVDKFSKGTDTFGFNVDSHGTITYREWAPNATHAFLTGDFNNWDRESHPMKRDEF
GVFEIVLPANNGQPAIPHNSKIKISLQTPSGDRIDRLPAWIKYVTQDLSVSPAYDARFWN
PPASERYQFKNPRPSKPASARIYEAHVGISSPELRVATYKEFTKNMLPRIRDLGYNVIQL
MAIMEHAYYASFGYQINSFFAASSRYGPPEDLKELVDTAHGMGITVLLDIVHSHASKNVL
DGLNEFDGTDHQYFHEGARGRHELWDSRLFNYGHHEVMRFLLSNLRFWMDEYHFDGFRFD
GVTSMLYHHHGIGTGFSGGYHEYFGADVDEEAVVYLMVANQMLHDLYPESITIAEDVSGM
PALCVPLSLGGLGFDYRLAMAIPDMWIKILKEQQDEEWDIGNICFTLTNRRHGEKTIALV
GDKSLMMHLCDAEMYTNMSNLTPFTSVIDRGMALHKMIRLLTHSLGGEGYLNFEGNEFGH
PEWLDFPREGNQNSFWYARRQFNLTEDHNLRYQYLNNFDRAMNTTEAQFGWLRSPQAYIS
LKNESDKIIVFERVGCVFIFNFHPNKSFGDYRVAIETPGTYKIVLISDSKDLGRPRPYRG
GHPIFHHSHGVELDGRTGRTFTFLAGPLW
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttgtcgagcagtccgccaactctctggccccgcaagccgcagctgctggt
gctgctactggcaaccgcactgacggcacaggcgtcatccagctcgacccctggctcgag
ccgttcgaggacgctttcaagaggcgatatgccaaagcgcaagactggctcaccaagctg
gacaagaccgagggcggcgtcgacaaattttccaagggcaccgatacctttggtttcaat
gtcgattcccatggcaccatcacatacagggagtgggcccccaatgccactcacgccttt
ctcaccggcgacttcaacaactgggaccgcgagtctcatcccatgaagagggacgaattc
ggcgttttcgaaattgtgcttcctgccaacaatggccagcctgccattccccacaactcc
aagatcaagatctctctgcaaacgcccagcggcgaccgtatcgaccgcctgccagcgtgg
atcaagtatgtcacccaggacctgtccgtctcgccggcatacgatgcccgcttctggaac
ccccccgcttcggagaggtatcagttcaagaaccccaggccgagcaagcctgcgagcgct
cgcatctacgaggcccacgtcggtatctcctcgccagaactgcgtgtcgctacgtacaag
gagttcaccaagaacatgctgccaaggatccgcgatcttggctataacgtcatccagctc
atggccattatggagcacgcctactatgccagctttggctaccagatcaacagcttcttc
gccgccagcagccggtacggaccccccgaagacctcaaggagctcgtggacactgctcac
ggcatgggcatcactgtgctcctcgatattgtccacagccacgcctccaagaacgtgctt
gatggactgaacgagttcgatggcaccgatcaccagtacttccacgagggtgctcgcggc
cgtcatgagctgtgggacagcaggctgttcaactatggtcaccatgaggtcatgcgattc
ctccttagcaacctccgcttctggatggacgagtaccactttgatggtttccgcttcgat
ggcgtgacaagcatgctttaccaccaccacggcatcggaactggcttctctggtggctat
cacgagtactttggcgccgatgttgacgaggaagcagttgtctacctcatggtggccaac
cagatgcttcacgacctgtatccagagagcatcaccattgccgaggatgtgtccggcatg
ccagctctttgtgtgccgctgtcgcttggtggccttggcttcgactaccgcctggctatg
gccatcccggacatgtggatcaagatcctgaaggagcagcaggatgaagaatgggacatt
ggtaacatctgcttcactctgaccaacagacggcatggcgagaagaccattgccctcgtc
ggagacaaatctcttatgatgcatctgtgtgacgccgagatgtacaccaacatgtcgaac
ctgactccgttcacctccgtcattgaccgtggcatggccctgcacaagatgatccgtctt
ttgacacattcccttggcggcgaaggatatctcaactttgaaggcaacgagtttggccat
ccagagtggctcgacttccctcgtgagggcaaccagaactcgttctggtacgcgaggcgg
cagttcaacctgacagaagatcataacttgcggtaccagtacctcaacaactttgatcgc
gctatgaacacaaccgaggcacagtttggatggctgcgcagcccccaggcctacatctct
ctgaagaacgagtctgacaagatcatcgtctttgagcgagtaggttgcgtcttcattttc
aacttccaccccaacaagagtttcggcgactaccgagttgcaatcgaaacgcctggcacg
tacaagattgttctcatttcggactccaaggatcttgggaggccacggccgtatcgagga
gggcacccgatttttcaccactcccatggagtggaattggacggaagaactggacgcaca
tttacattccttgcaggaccgctctggtaa

DBGET integrated database retrieval system