KEGG   Verticillium albo-atrum: VDBG_03554Help
Entry
VDBG_03554        CDS       T02227                                 

Definition
endoglucanase B
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
val  Verticillium albo-atrum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:val00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MKSQIGFAALLALSNQALAQQTAYGQCGGNGWTGLTTCVSGYFCNAYHELHSRPSPPGHN
HHGPGSSWHDDQHQTCHHTEDSWEWADVRSGDLVVIQQRFRAIWVQIAKKLACKSSRVSF
ESINEPPADNAVDGANVNKFNELFVSAVNEAGGHNAKRVLQLAGGVSDPIKTTQWFKAPA
NIQNPWALQFHYYSPYDFIFGAWGKTIWGSAADRAALTADFQAVRGNFSNVPLVLGEFDA
SPLNTEPAARWKWTDHLARIATDLGVALVIWDNGLDHLDRNTGVWRDPVSIALIEAAVAG
ERSSLPDSTEDAGASTQSSSAYLWNKVGNAVADQVLPWLFNGNTLTGITTQTGDALSAGS
DYTVSSNAITFKAGFLSDYLGPNVTPGSKANLTLTFSAGAHSNIEVVQWDTPVLVTEPDA
TPGQDLQIPINGRAYPCLPLCVLRLPTAPSCSMTGRSGSDLCNVDACHYFWEGSNVILRA
SAIAAVLELNKAVKFTFEFYPRVAGNSVTYTLDPTDEC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgcaaatcggtttcgccgcgctcctggcgctctctaaccaggctctggcccag
cagacggcgtatggccagtgtggtggtaacggctggactggccttacgacctgcgtctct
ggctacttctgcaatgcgtaccacgagttgcattcccggccaagcccccccgggcacaac
caccacggccccggctcctcctggcacgacgaccagcaccagacctgccaccacactgaa
gactcgtgggagtgggcagatgttcgcagcggcgacctcgttgttattcagcagcgtttc
cgcgccatctgggtgcaaatcgctaagaaactcgcttgcaagagctctcgtgtttcgttt
gaatccatcaatgagccccccgccgacaacgcagtcgatggcgccaacgtcaacaagttc
aacgagcttttcgttagtgccgtcaacgaggctggcggtcacaacgccaagcgtgtgctc
caactggccggcggtgtcagcgatcctatcaagacgactcagtggttcaaggcccccgct
aacattcagaacccttgggcccttcagttccactactactcgccctacgacttcatcttc
ggtgcctggggcaagaccatctggggctctgccgctgatcgcgctgctctgaccgccgac
ttccaggctgttcgcggcaacttctccaacgtgcccctcgtcctcggcgagttcgatgcc
agccccctcaacacggagcctgccgcacgttggaagtggactgatcatctagcccgcatt
gctaccgatctcggcgttgctctcgtcatctgggacaatggtctggatcatctcgaccgg
aacactggcgtgtggcgcgatcccgtgtccatcgctctcatcgaggctgccgttgctggc
gagcgcagctcccttcccgacagcacggaagatgccggcgcgtcgactcagtcgtcctct
gcctacctctggaacaaggtcggcaatgctgtggctgatcaagtgcttccctggctcttc
aacggtaacaccctgactggtatcacaacccagactggtgacgccttgtcagcgggttct
gattacaccgtgtcctccaatgccatcaccttcaaggccggcttcctttctgactacctc
ggccccaacgtgactcctggaagcaaggccaaccttactttgaccttctcggccggtgcc
cattccaacattgaggttgtccagtgggacacccctgttctcgtcaccgagcccgatgcc
actcccggccaggacctccagatccccatcaatggaagggcgtacccgtgcttgccgctg
tgcgtgctgaggctgccgacggcaccatcctgttcgatgactggacgcagtggctcggac
ctctgcaacgtggacgcctgccactacttctgggagggcagcaatgtcattctgcgcgcg
tcggccatcgccgccgtgcttgagctgaacaaggccgtcaagttcacctttgagttctac
ccccgtgtagcgggtaactcggtcacctacacactcgacccgacggacgagtgttaa

DBGET integrated database retrieval system