KEGG   Verticillium alfalfae: VDBG_03657Help
Entry
VDBG_03657        CDS       T02227                                 

Definition
histone deacetylase clr3
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     VDBG_03657
Protein phosphatases and associated proteins [BR:val01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VDBG_03657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MQKDAPMDGEDWQMRDAAGSNGVAGPQPPPDQGPSVNGTTSSDEEYDEGYDEEYEESEDA
TIVSQLRRRGQLPTGCCYDDRMKLHCNADFTSHPHHPEDPRRIEEIIKAFKKAGLLYTGP
EANVAKIVQDTPTKYMWRIAAREAAKEEILLAHTPDHFAWVENLSTMSYTELRALSVELD
KGRASLYVGSLSFPAALLSCGGAIDTCKQVVESNVKNAFAVIRPPGHHAEYDQSLGFCFF
NNVPVAVKVCQQEYPEICRKVLVLDWDVHHGNGIQNIFYQDPNVLYISIHVYENGQFYPG
QPENPMVPDGGMEHCGTGPGLGKNINIGWHAQGMGDGEYMAAFQKIIMPIAKEFNPDLVV
ISAGFDAADGDELGGCFVTAPHATPT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagacgcccccatggacggggaggactggcagatgcgcgatgccgcaggatcc
aacggtgttgcagggccccagcctcctccagaccagggcccctcagtcaacggcactact
tcctccgacgaggagtacgacgaaggctatgatgaggagtacgaggagtcagaggacgcc
actatcgtgtctcagctgcgccggcgtggtcagcttccaacaggatgctgttacgatgat
cggatgaagctacactgtaacgccgactttacctctcatcctcaccacccggaggaccca
cgtcgcatagaggagatcatcaaggcttttaagaaagctggtttgctctatacagggccc
gaagccaatgttgccaagattgtccaggataccccgacaaagtacatgtggcgcatcgcg
gcccgcgaagcagccaaggaagagattctcctcgcgcataccccagatcactttgcctgg
gtagagaacctatcgaccatgtcctacaccgaacttcgtgccctcagtgtagagctcgac
aagggccgtgcctctctctacgtcggcagtctgtcctttccggcggcactgctatcgtgt
gggggcgccatcgacacatgcaagcaggttgtcgagagcaatgtcaagaacgccttcgct
gtcatccggccgccaggacaccatgccgagtacgaccagtctctcgggttttgtttcttc
aacaacgtcccagttgctgtcaaggtctgccagcaggaataccccgaaatctgccgcaag
gtcctcgtgctcgactgggacgttcatcacggcaacggcattcaaaacatcttctaccaa
gatcctaacgttctctacatatcaatacacgtctacgagaacggccagttctaccctggc
cagcctgaaaaccccatggtaccggatggtggcatggagcattgcggtaccggtcctggt
ctcggcaagaacatcaacatcggctggcacgcgcaaggcatgggtgacggcgaatacatg
gctgccttccagaagatcatcatgcccatcgcaaaggagttcaaccctgatctcgtagtc
atctcggcaggtttcgatgctgctgacggcgacgagctcggtggctgcttcgtaaccgcc
ccccatgctacgcccacatga

DBGET integrated database retrieval system