KEGG   Verticillium alfalfae: VDBG_03679Help
Entry
VDBG_03679        CDS       T02227                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
val  Verticillium alfalfae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VDBG_03679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 106 aa AA seqDB search
MAGGDAKKGASLFKTRCAQCHTVEAGGGNKIGPALHGLFGRKTGSVDGYSYTDANKQKGI
EWNNDTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDATA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggtgacgccaagaagggtgcttccctcttcaagacccgttgcgctcagtgc
cacaccgtcgaggctggcggcggcaacaagatcggccctgcgctgcacggcctctttggc
cgcaagaccggttccgtcgacggctactcctacaccgatgccaacaagcagaagggcatt
gagtggaacaacgacactctgttcgagtacctcgagaaccccaagaagtacattcccggc
accaagatggccttcggtggtctcaagaaggccaaggacaggaacgacctgatcgcctac
ctcaaggacgctaccgcctaa

DBGET integrated database retrieval system