KEGG   Verticillium albo-atrum: VDBG_03679Help
Entry
VDBG_03679        CDS       T02227                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
val  Verticillium albo-atrum
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:val00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 106 aa AA seqDB search
MAGGDAKKGASLFKTRCAQCHTVEAGGGNKIGPALHGLFGRKTGSVDGYSYTDANKQKGI
EWNNDTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDATA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctggtggtgacgccaagaagggtgcttccctcttcaagacccgttgcgctcagtgc
cacaccgtcgaggctggcggcggcaacaagatcggccctgcgctgcacggcctctttggc
cgcaagaccggttccgtcgacggctactcctacaccgatgccaacaagcagaagggcatt
gagtggaacaacgacactctgttcgagtacctcgagaaccccaagaagtacattcccggc
accaagatggccttcggtggtctcaagaaggccaaggacaggaacgacctgatcgcctac
ctcaaggacgctaccgcctaa

DBGET integrated database retrieval system