KEGG   Verticillium alfalfae: VDBG_03861Help
Entry
VDBG_03861        CDS       T02227                                 

Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VDBG_03861
Transcription machinery [BR:val03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     VDBG_03861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 358 aa AA seqDB search
MKPIPFPEKPAVIEERNNEIEFRVVNNDNERESLIILTGLKCIFQKQLPKMPKDYIARLV
YDRTHLSIAIVKKPLEVVGGITYRPFKGRQFAEIVFCAISSDQQVKGYGAHLMSHLKDYV
KATSDVMHFLTYADNYAIGYFKKQGFTKEITLPRSVWMGYIKDYEGGTIMQCSMLPRIRY
LEMGRMLLKQKECVQAKIRAFSKSHIVHAPPKEWKNGVKPIDALTAVPAIRASGWSPAMD
ELARQPRHGPNYNQLLHLLNDMQNHASAWPFLIPVNKDDVADYYDVIKEPMDLSTMEVKL
EADQYATPEDFTRDAKLVFDNCRKYNNETTPYAKSANKLEKFMWAQIKAIPEWSHLEP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctattccatttcccgaaaagcccgccgtcatcgaagagcgcaacaacgagatc
gagtttcgtgttgtcaacaacgataacgagcgcgagtccctcatcatcctcactggtctc
aaatgcatcttccagaaacagctcccgaagatgcccaaggattacattgcccgcctcgtc
tacgaccgcacgcacctgtcgatcgccattgtgaagaagcccctcgaagtcgtgggaggt
attacctaccgccccttcaagggacgacagtttgccgagatcgtcttctgcgccatctct
agcgaccagcaggtcaagggctacggcgcccatctcatgtcgcacctcaaggactacgtc
aaggcgacgagcgacgtcatgcacttcctcacctatgccgacaactacgccattggctac
ttcaagaagcaggggttcaccaaggagatcacgctgccgcggtccgtgtggatgggctac
atcaaggactacgaaggcggcacgatcatgcagtgctcgatgctgccgcgcatccgctac
ctcgagatgggccgcatgctgctcaagcagaaggagtgcgtgcaggccaagattcgggcc
ttttccaagtcgcacattgtgcacgcgccgcccaaggagtggaagaacggcgtcaagccc
atcgacgccctgacggcggtgcccgccatccgcgcctcgggctggtcgccggccatggac
gagctcgcgcgccagccccgccacgggcccaactacaaccagctcctccacctgctcaac
gacatgcagaaccacgcctcggcctggccgttcctcatccccgtcaacaaggacgacgtc
gccgactactacgacgtcatcaaggagcccatggacctcagcaccatggaggtcaagctc
gaggccgaccagtacgccacgcccgaggattttacccgcgacgccaagctcgtctttgac
aactgccgcaagtacaacaacgagacgaccccgtacgccaagtcggccaacaagctcgaa
aagttcatgtgggcccagatcaaggccatccccgagtggtcgcacctcgagccgtag

DBGET integrated database retrieval system