KEGG   Verticillium alfalfae: VDBG_03871Help
Entry
VDBG_03871        CDS       T02227                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
val  Verticillium alfalfae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VDBG_03871
Translation factors [BR:val03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    VDBG_03871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MAVVENPTANEQVDLTTIPVSPGGDQPETGATSSSDDVKTVFHDKENFNVKHPLQNKWTL
WFTKPPSGKGDNWNDLLKEVITFDSVEEFWGIYNNIAPVSELALKSDYHLFKAGVRPEWE
DAQNKHGGKWSYQFKEKRNVAIDDLWLHVMLAAIGETLEDEEDGEVMGVVVNVRKAFFRV
GVWTRTIGKSIPGRGDGDVAGGKGRTPEKGKKVLLEIGTKFKQLLDLPANEAVEFSGHTD
SAHSGSSRAKAKHTV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgtcgagaaccccacggccaacgaacaggtcgacctgaccactattcctgtc
tctcctggcggtgaccagcccgaaactggcgccaccagctccagcgacgatgttaagact
gtcttccatgacaaggagaacttcaacgtcaagcaccccctccagaacaagtggactctc
tggttcaccaagccacccagcggcaagggcgacaactggaacgatttgctcaaggaggtc
attacctttgattccgtggaggagttctggggcatctataacaacattgcgcccgtctcc
gagctggccctgaagtctgactaccacctcttcaaggctggcgtccgtcccgagtgggag
gacgctcagaacaagcacggcggaaagtggtcctaccagttcaaggagaagcgcaacgtc
gccattgacgacctgtggctccatgtcatgctcgctgccatcggcgaaaccctggaggat
gaggaggatggcgaggtcatgggcgtcgtcgtcaacgttcgcaaggccttcttccgtgtc
ggcgtctggactcgcaccataggaaagagcattccaggccgtggcgacggtgatgtggcc
ggcggcaagggccgcacccccgagaagggcaagaaggtcctcctcgagattggcaccaag
ttcaagcagctgcttgacctccccgctaacgaggccgtcgagttctctggccacaccgac
tctgcacacagtggtagcagtcgtgccaaggccaagcacaccgtctaa

DBGET integrated database retrieval system