KEGG   Verticillium albo-atrum: VDBG_03903Help
Entry
VDBG_03903        CDS       T02227                                 

Definition
proclavaminate amidinohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
val  Verticillium albo-atrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:val00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MKAVSLLSPLLHLCWASHPPSAQVPLLDNDDVDLTDSNHYSGIRTFANLPYVNCFSNRDA
KDHKYDIAILGAPHDTTTTGRPGARYGPSGIRTGSQRKGPEWSIYTGRNPLADWATVVDC
GDAHLTWLDSRVSLQRLDKAHEVLAGRPAANASVSATPRILTLGGDHTTTLSALRSTSAR
WGPVSVIHFDSHIDTWDPAVLGGDISDYAALNHGTFLHVAHEEHLILNSSVHAGVRAPLV
RRKGDLRNDARCGFAMVTARDIDALGVQGVVSRIRERVGDSLVYISVDIDVLDPAFAPGT
GTAEPGGWSTRELLAILDGLEGLPVVGADVVEVAPAYDTNGEITVLAAAEIAYSLVDLMV
FRPVKSKADNGE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcagcctcctctcgcctctcctccacttgtgctgggcctcgcatccaccc
agcgcccaggtacccttgcttgacaatgacgatgttgatctgaccgacagcaatcattac
tccggcatcaggacatttgcgaacctgccgtatgtcaattgcttctccaaccgggacgca
aaggaccacaagtacgacattgccatcctcggcgcccctcatgataccacgacaacaggc
cggccaggcgctcgctatggcccgtctggcatcaggaccggcagccagcgcaagggtccc
gaatggagcatctacactggccgcaaccccctcgccgactgggccacggtagtcgactgc
ggcgacgcccacctcacctggctcgacagccgcgtctccctccagcgcctcgacaaggcc
catgaggtcctcgctggccgccccgccgccaacgcctccgtctcggcgacgccgcgcatc
ctcacgctcggcggcgaccacaccacgaccctgtccgccctgcgctcgacctcggcgcgc
tggggccccgtctccgtcatccactttgatagccacattgacacctgggacccggccgtc
ctgggcggcgacatatccgactacgccgccctcaaccacggcaccttcctgcacgtggcg
cacgaagagcacctcatcctcaactcatccgtccacgccggcgtccgcgcgccgctggtg
cgccggaagggcgatctccgcaacgacgcgcgctgcggcttcgccatggtcacggcacgg
gacattgacgcgctcggcgtccagggcgtcgtttcgaggatccgcgaacgcgttggcgat
tcgttggtgtacatcagcgtcgatatcgatgtcctcgatccggcctttgcgccagggact
ggcacggctgaacctggtggctggtctacgcgcgagctgctggcgatccttgacgggctt
gagggcttgcctgttgtgggcgcggatgtcgtcgaagtggctccggcgtatgacacgaat
ggcgagattaccgtgcttgctgctgctgagattgcgtactcgctggttgatctcatggtg
tttcggcccgtgaaatccaaggcggacaacggggagtga

DBGET integrated database retrieval system