KEGG   Verticillium alfalfae: VDBG_04023Help
Entry
VDBG_04023        CDS       T02227                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
val  Verticillium alfalfae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VDBG_04023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VDBG_04023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VDBG_04023
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VDBG_04023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MDHIRKTFQRCKAENRVSRSALVTYVTAGFPTAEETPDILLAMEKGGADILELGAPFTDP
IADGPTIQTSNTIALQNGVTIESTLKMVKDARSKGLKAPVLLMGYYNPLLSYGEERLLND
CADSGVNGFIVVDLPPEEAVSFRKLCNKGQLSYVPLIAPATSDARMKILCQLADSFIYVV
SRQGVTGALGSLNANLPELISRVKKYSGDKPAAVGFGVSTREHFQSLATLSDGVVVGSQI
ITTLQKATPENRLKDLEEYCAYLGGRRPEAANETTREVGIVEAIADAKAPEPVPTGHHHG
RAGQRPERAARRHARQDSRALRRIRRTINNDPKFWEEYRSYYDYMGRPGHLHLAERLTEH
AGGANIWLKREDLNHTGSHKINNALGAGQHGVATATVCAKFGMECTVYMGAEDVRRQALN
VFRMKLLGAKVSVIGEETKRQMQEKRGKLPDAVVACVGGGSNAVGMFYPFSNDPSVRLVG
VEAGGDGVETARHSATLSGGTKGVLHGVKTYVLQDKHGQISETHSVSAGLDYPGVGPELS
SWKDSNRAQYVVATDAEAFIGFRLMSQLEGIIPALESAHGIYGALELAKTMKKDEDVVIC
LSGRGDKDVQSVADELPTLGPKIGWDLRF
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggatcacattcgcaagacttttcagcgctgcaaggccgagaacagggtgagtcgatca
gccctcgtgacatatgtcaccgccggctttcctacggctgaggagacgcctgatattctc
ctcgctatggagaagggtggagctgatatcctcgagctcggcgcgcccttcacagaccct
atcgccgacggcccgaccattcagacctccaacacaattgctctgcaaaatggcgtcacc
atcgagtccacactgaagatggtcaaggatgcgaggagtaagggcctcaaggcgccagtt
ctgctgatgggatactacaaccctctcttgagttacggcgaggagaggctcctcaacgac
tgcgctgacagcggcgtcaatggcttcatcgttgtcgacctgccgcccgaggaggccgtc
tcgttccgcaagctttgcaacaagggacaactctcctacgttccccttatcgcgcccgcc
acatctgatgcccgcatgaagattctctgccagctcgccgactctttcatctacgtcgtt
tcccgccaaggcgttaccggtgccctcggctccctgaacgccaacctccccgaactcatc
tcccgcgtgaagaagtacagcggcgacaagcccgccgctgtcggctttggcgtcagcacc
cgcgaacacttccagagccttgctaccctctccgatggtgtcgtcgtcggcagccagatc
atcacgaccctgcagaaggccacccctgagaaccgcctcaaggacctcgaggagtactgt
gcctatctcggcggccgcaggcccgaggccgcgaacgaaacgacgcgcgaagtcggcatc
gttgaggccattgccgatgccaaggcccccgagcccgttcctaccggccaccatcacggc
cgagcaggacagcgacctgaaagggcagctcgccgccatgcacggcaagattcccgagcg
cttcggcgaattcggcggacaatcaacaacgaccccaagttctgggaggagtacaggtcc
tactacgactacatgggccgacctggccacctgcacctcgcagagcgcctgacagagcac
gctggaggtgccaacatttggttgaagcgtgaggatctcaaccacacgggctcccacaag
atcaacaatgcgctgggcgccggccagcacggtgtcgcgacggcgactgtctgcgccaag
ttcggcatggagtgcaccgtctacatgggcgccgaggacgtgcgccgccaggctctcaac
gtgttccgcatgaagctcctcggcgccaaggtttccgtcattggcgaggagacgaagcgc
cagatgcaggagaagcgcggcaagctgccggacgccgtcgtcgcctgcgtcggcggcggc
agcaacgccgtcggcatgttctaccccttttccaacgaccccagtgtccggcttgtcggt
gtggaggccggcggcgacggcgtcgagacggcgcgccacagtgccacgctctccggcggc
acgaagggtgtgctgcacggcgtcaagacgtacgtcctgcaggacaagcacggtcagatt
tccgagacgcactccgtctcggctggtctcgactacccgggtgtcggccccgaactgagc
tcctggaaagacagcaaccgcgcccagtacgttgtcgccaccgatgcggaggcctttatc
ggcttccgcctcatgagccagctcgagggtatcattcccgcgctcgagtcggcgcacggc
atctatggtgcgctcgagctcgccaagacgatgaagaaggacgaggacgtcgtcatctgc
ctcagtggacgtggtgacaaggacgtgcagagcgtggccgacgagctgccgacgttggga
cctaagattggctgggacttgcgattttag

DBGET integrated database retrieval system