KEGG   Verticillium alfalfae: VDBG_04105Help
Entry
VDBG_04105        CDS       T02227                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-4
  KO
K03259  translation initiation factor 4E
Organism
val  Verticillium alfalfae
Pathway
val03013  RNA transport
Module
val_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VDBG_04105
Messenger RNA biogenesis [BR:val03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     VDBG_04105
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     VDBG_04105
Translation factors [BR:val03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    VDBG_04105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 9534633
NCBI-ProteinID: XP_003006152
UniProt: C9SFQ1
AA seq 360 aa AA seqDB search
MDNNLWTRRTNSGKLSLSTPSHGNSTSTGGDSARNGSGSFSKRFGGATSSQGKNDPFSAT
AATTPGGSSLASPTTGASNAFGLGSGAFASFGSAKTPKTPGNPFELAMGKAPASKTPGAD
GKAPSMASIAETGSSANFRTGQGSQTSSARGSSEVARPQAGLKVHPLKYEWVTWCRPCQP
KGQPYEEYAKSLTAMVHCKSIEEFVVGFRHLKHPSELPVGWEYHFFKRGIRPIWEDEINR
SGGKWVLRLKKGIADRYWEDTRFALLGEAFQDVGEEICGGVVSIRNGEDVISIWTRSTGG
RVLKIRETWKNYLQCPPNTIFEFKSHDESIQHRAAIEESRREKHQDKRKQAPGDEQKQSS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacctatggactcgccgcactaactcaggcaagctttccctctcgactccc
agccatggcaattcgacgtcaacgggcggcgattccgcccgcaatggctccggctccttc
tccaagagattcggcggcgccacctcctcccaaggcaaaaatgatcccttcagtgcgacg
gccgctacgacgcccggcggctcctctttagcttcccccaccacgggagcttccaatgcc
ttcggtctaggctctggggcttttgcgtccttcggttctgcgaaaacccccaagacccct
ggcaaccctttcgagcttgccatgggcaaggcacctgcgtccaagacccccggtgccgac
ggcaaggccccctcgatggcctctatcgccgagaccgggtcgtccgccaacttccggacc
ggccagggctctcagaccagctccgcccgtgggtcgtctgaggtcgcccgcccacaggcc
ggcctcaaggtgcaccctctgaaatatgagtgggttacctggtgccggccgtgtcagccc
aagggtcagccgtacgaggagtacgccaagtccctgactgccatggtgcactgcaagtcc
atcgaggagtttgtcgtcggcttccgccacctcaagcacccctcggagttgcctgtggga
tgggagtaccacttcttcaagagaggcatcaggcctatctgggaggacgagatcaaccgc
agcggcggtaaatgggtcctgcgtctgaagaagggcattgccgaccgatactgggaggac
acgcgctttgcgctcctgggtgaggccttccaggatgtcggcgaggagatctgtggtggc
gttgtcagcatccgcaacggtgaggatgttatcagcatttggactcgttcgactggcggc
cgcgtgctgaagattcgtgaaacctggaagaactacctccagtgcccgcccaacacaatc
ttcgagttcaagtctcacgacgagagcatccagcaccgagccgcgatcgaggagtcccgc
cgcgagaagcaccaggacaagcgcaagcaggcccccggcgatgagcagaagcaatctagt
tag

DBGET integrated database retrieval system