KEGG   Verticillium albo-atrum: VDBG_04105Help
Entry
VDBG_04105        CDS       T02227                                 

Definition
eukaryotic translation initiation factor 4E-4
Orthology
K03259  
translation initiation factor 4E
Organism
val  Verticillium albo-atrum
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:val03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MDNNLWTRRTNSGKLSLSTPSHGNSTSTGGDSARNGSGSFSKRFGGATSSQGKNDPFSAT
AATTPGGSSLASPTTGASNAFGLGSGAFASFGSAKTPKTPGNPFELAMGKAPASKTPGAD
GKAPSMASIAETGSSANFRTGQGSQTSSARGSSEVARPQAGLKVHPLKYEWVTWCRPCQP
KGQPYEEYAKSLTAMVHCKSIEEFVVGFRHLKHPSELPVGWEYHFFKRGIRPIWEDEINR
SGGKWVLRLKKGIADRYWEDTRFALLGEAFQDVGEEICGGVVSIRNGEDVISIWTRSTGG
RVLKIRETWKNYLQCPPNTIFEFKSHDESIQHRAAIEESRREKHQDKRKQAPGDEQKQSS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacctatggactcgccgcactaactcaggcaagctttccctctcgactccc
agccatggcaattcgacgtcaacgggcggcgattccgcccgcaatggctccggctccttc
tccaagagattcggcggcgccacctcctcccaaggcaaaaatgatcccttcagtgcgacg
gccgctacgacgcccggcggctcctctttagcttcccccaccacgggagcttccaatgcc
ttcggtctaggctctggggcttttgcgtccttcggttctgcgaaaacccccaagacccct
ggcaaccctttcgagcttgccatgggcaaggcacctgcgtccaagacccccggtgccgac
ggcaaggccccctcgatggcctctatcgccgagaccgggtcgtccgccaacttccggacc
ggccagggctctcagaccagctccgcccgtgggtcgtctgaggtcgcccgcccacaggcc
ggcctcaaggtgcaccctctgaaatatgagtgggttacctggtgccggccgtgtcagccc
aagggtcagccgtacgaggagtacgccaagtccctgactgccatggtgcactgcaagtcc
atcgaggagtttgtcgtcggcttccgccacctcaagcacccctcggagttgcctgtggga
tgggagtaccacttcttcaagagaggcatcaggcctatctgggaggacgagatcaaccgc
agcggcggtaaatgggtcctgcgtctgaagaagggcattgccgaccgatactgggaggac
acgcgctttgcgctcctgggtgaggccttccaggatgtcggcgaggagatctgtggtggc
gttgtcagcatccgcaacggtgaggatgttatcagcatttggactcgttcgactggcggc
cgcgtgctgaagattcgtgaaacctggaagaactacctccagtgcccgcccaacacaatc
ttcgagttcaagtctcacgacgagagcatccagcaccgagccgcgatcgaggagtcccgc
cgcgagaagcaccaggacaagcgcaagcaggcccccggcgatgagcagaagcaatctagt
tag

DBGET integrated database retrieval system