KEGG   Verticillium alfalfae: VDBG_04164Help
Entry
VDBG_04164        CDS       T02227                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
val  Verticillium alfalfae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_04164
Enzymes [BR:val01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     VDBG_04164
Glycosyltransferases [BR:val01003]
 Polysaccharide
  Storage polysaccharide
   VDBG_04164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 712 aa AA seqDB search
MSQDERSAREVKDHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGERYTLIGPLNHQSA
AVEVEELEPTVPELAATINSMKERGIGILYGRWLIEGAPRVLLFDTKTAYKFLDEWKTDL
WNVASIPSPPNDDETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLCKKR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHACDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQAKEKIHEFVRGHFYG
HYDFDPENTLYFFTAGRYEFRNKGVDMFVESLARLNHRLKSAGSKMTVVAFIIMPAQTTS
LTVEALKGQAVMKSLRDTVDIIERGIGKRIFERSLKWHDGDPLPDEKELITGADRVLLRR
RLFAMKRHGLPPIVTHNMLNDSEDPILNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLP
MDYDEFVRGTHMGIFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRMKGVDDSVNSLTSHMFDFCQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPGSFQGDEEEDTILGVEQKISRPFSVPGSPRDRSGMMTPGDFASLQEGREGLS
TEDYVAWKLPEEEDPEEYPFPLTLRTKRVGPPSPLDGVPLQPTNGNGAGSSN
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagacgagcgttccgcccgtgaggtgaaggatcatctcctcttcgaaatcgca
acggaagttgctcaccgagttggcggcatctactctgtgatcaagtcaaaggcccccgtc
acaacagccgaatatggcgagcgctacaccctcatcggtccgctgaaccaccaatcggcc
gccgtcgaagtcgaggagctcgagcccaccgttcctgagcttgctgccacgatcaactcc
atgaaggagcgcggtatcggcattctctatggtcgctggctgattgagggcgcaccccga
gtgctcctgttcgacaccaagaccgcttacaagttccttgatgagtggaagacggacctg
tggaacgtcgccagcattccctcgccacccaatgacgacgagacgaatgaggccatcgtt
ttcggatacctggtcgcgtggttcctcggagagtttgtctgccacgagaagaaaaaggcc
gtcattgcgcacttccacgagtggctcgccggtgtcgcattgcccttgtgcaagaagcgc
cgcattgatgtgaccaccatcttcaccactcacgccacgctgcttggtcgttacctctgt
gctggctcggtcgacttttacaacaacctgcagtggttcgatgtggacgccgaggctggc
aagcgcggtatataccacaggtactgcatcgagcgagctgctgcccacgcctgcgatgta
ttcacgactgtctcccacattacagcgtacgagagcgagcacctgctcaagcgcaagcct
gacggcgttctgcccaacggcctcaacgtcaccaagttctcggctgtccacgaattccag
aacttgcatcagcaggcgaaggagaagattcacgaatttgtgcgaggccatttctacggc
cactatgatttcgacccggagaacacgctgtacttcttcacggccggtcgttacgagttc
aggaacaagggtgttgacatgtttgttgagtcgctggcacgcctcaaccaccgcctcaag
agcgctggcagcaagatgacggtcgtggccttcatcatcatgcctgcccagacgacatcg
ctgactgtcgaggctctcaagggccaggccgtcatgaagtcactgcgggacactgttgac
atcatcgagcgtggcattggcaaacgcatcttcgagcgctctctgaagtggcacgacggc
gacccgctccccgatgagaaggagctgatcaccggtgctgaccgcgtcctcctgcggaga
cgcctcttcgcgatgaagaggcacggcctgcctcccatcgtcacccataacatgctgaac
gatagcgaagatcctatcctgaaccagattcgtcgggtccagcttttcaaccacccttct
gaccgagtcaaggttgtcttccacccagaattcctcaactctgccaaccccgtcctgccc
atggactacgacgagtttgtacgtggcacgcacatgggcatcttcgcatcctactacgag
ccttggggctacaccccggccgagtgcacggtcatgggcgttcccagcattaccacgaac
ttgtctggctttggctgctacatggaggagctcatcgagaactcgagcgattacggtatc
tacattgttgaccgccggatgaagggtgtcgatgactcggtcaactcgttgacctcgcac
atgttcgacttttgccagaagagccgtcgccagcgtatcaatcagcgtaaccgcacggag
cgtctcagcgacctgctcgactggaagaggatgggcatggagtacgtcaaggcgcgccaa
ctggcgctgcgccgggcctatcctggatcgttccagggtgacgaggaggaggacacgatt
ctcggtgtcgagcagaagatctcacgacctttctcggtgcccgggtctcctcgtgaccgt
tctggcatgatgacgcctggtgactttgccagcctgcaagagggccgcgaaggcctgagc
actgaggactatgtcgcttggaagctgcctgaggaggaagaccctgaggagtaccccttc
ccgctgacgctgcgcacgaagcgtgtcggcccacccagccccctcgacggcgtgcctctg
caacctacaaacggcaacggcgctggtagcagcaactag

DBGET integrated database retrieval system