KEGG   Verticillium albo-atrum: VDBG_04396Help
Entry
VDBG_04396        CDS       T02227                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
val  Verticillium albo-atrum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:val04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MKPFSTPVLAKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSR
PLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMT
GYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLG
TPPDDVINGIASENTLRFVKSLPKRERQPLKNKFKNADPSAIDLLEKMLVFDPKKRITAT
EALSHEYLSPYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDANVAQLE
EQLNAQAAQQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttcagtaccccggttctcgccaagcgaacgtaccgcgagctgaagcttctc
aagcacctcagacacgagaatgtcatttccctgagcgacatcttcatttcccccctcgag
gacatctactttgttaccgagcttctcggcaccgacttgcaccgtctactcacctccagg
cctctggagaagcaattcatccaatacttcctctaccagatcatgcgcggcctcaagtac
gtgcactcagcgggcgtcgtccaccgtgacctcaagcccagcaacatcttggtcaacgag
aactgtgatttgaagatttgcgacttcggcctggcgcgcatccaggatccccagatgaca
ggctatgtctcgacgcgttactaccgcgcgccggaaatcatgctcacgtggcagaagtat
gatgtcgaggtggatatctggagtgcgggctgtatcttcgccgagatgctcgagggcaag
ccgctcttccctggcaaggaccacgtcaaccagttcagtatcattacggagctcctcggc
acaccacccgacgacgtcatcaacggcatcgccagcgaaaatacgctgcgctttgtcaaa
tcgctgcccaagcgcgagcgccagccgctcaagaacaagttcaagaatgccgacccttcg
gccatcgacctgctagagaagatgcttgtcttcgatcccaagaagaggataacggcgacc
gaggcgctgtcgcacgaatacctctctccctaccacgatcctaccgacgagcccgtcgcc
gaggagaagttcgactggagcttcaacgatgctgacctgcctgttgacacgtggaagatc
atgatgtactccgagatcctcgactaccataatgtggacgccaacgtggcacaactcgag
gaacagctcaacgctcaggcggcgcaacaatga

DBGET integrated database retrieval system