KEGG   Verticillium alfalfae: VDBG_04396Help
Entry
VDBG_04396        CDS       T02227                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
val  Verticillium alfalfae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    VDBG_04396
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     VDBG_04396
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   VDBG_04396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MKPFSTPVLAKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSR
PLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMT
GYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLG
TPPDDVINGIASENTLRFVKSLPKRERQPLKNKFKNADPSAIDLLEKMLVFDPKKRITAT
EALSHEYLSPYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVDANVAQLE
EQLNAQAAQQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttcagtaccccggttctcgccaagcgaacgtaccgcgagctgaagcttctc
aagcacctcagacacgagaatgtcatttccctgagcgacatcttcatttcccccctcgag
gacatctactttgttaccgagcttctcggcaccgacttgcaccgtctactcacctccagg
cctctggagaagcaattcatccaatacttcctctaccagatcatgcgcggcctcaagtac
gtgcactcagcgggcgtcgtccaccgtgacctcaagcccagcaacatcttggtcaacgag
aactgtgatttgaagatttgcgacttcggcctggcgcgcatccaggatccccagatgaca
ggctatgtctcgacgcgttactaccgcgcgccggaaatcatgctcacgtggcagaagtat
gatgtcgaggtggatatctggagtgcgggctgtatcttcgccgagatgctcgagggcaag
ccgctcttccctggcaaggaccacgtcaaccagttcagtatcattacggagctcctcggc
acaccacccgacgacgtcatcaacggcatcgccagcgaaaatacgctgcgctttgtcaaa
tcgctgcccaagcgcgagcgccagccgctcaagaacaagttcaagaatgccgacccttcg
gccatcgacctgctagagaagatgcttgtcttcgatcccaagaagaggataacggcgacc
gaggcgctgtcgcacgaatacctctctccctaccacgatcctaccgacgagcccgtcgcc
gaggagaagttcgactggagcttcaacgatgctgacctgcctgttgacacgtggaagatc
atgatgtactccgagatcctcgactaccataatgtggacgccaacgtggcacaactcgag
gaacagctcaacgctcaggcggcgcaacaatga

DBGET integrated database retrieval system