KEGG   Verticillium albo-atrum: VDBG_04405Help
Entry
VDBG_04405        CDS       T02227                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
val  Verticillium albo-atrum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:val01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:val01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MGVIFPTLVCGLGWGDWLGGYVYAGILRIFFVQQATFCINSLAHWIGDQPFDDRNSPRDH
VITALFTLGEGYHNFHHEFPSDYRNAIQWWQYDPTKWMIWTWKQLGLASDLKQFRANEIE
KGRVQQLQKKLDQKRATLDWGIPLEQLPVVDWDDFVAQSKEGKGLIAVAGVIHDVTDFIK
DHPGGRALINSAIGKDATAIFNGGVYLHSNAAHNLLSTMRVGVLRGGCEVEIWKRAQFEN
KDMTYVTDSSGQRIVRAGDQLTRVAQPTKGADAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatcttccccactctggtctgcggtctcggctggggtgactggcttggtggc
tacgtctacgccggcattctccgcattttcttcgttcagcaggctactttctgcatcaac
tccctcgcccactggatcggcgatcagcccttcgatgaccgcaacagtcctcgcgaccat
gtgatcactgctctcttcacccttggtgagggctaccacaacttccaccacgagttcccc
tcggactaccgcaacgccattcagtggtggcagtacgaccccaccaagtggatgatctgg
acctggaagcagcttggcctcgcctccgacctcaagcagttccgtgccaacgaaattgag
aagggacgtgtccagcagctccagaagaagcttgaccagaagcgcgccactctcgactgg
ggcatccctctcgagcaactccctgttgtcgactgggatgactttgttgcccagagcaag
gagggcaagggtcttatcgctgtcgctggtgtcatccacgacgtgaccgacttcattaag
gaccatcccggtggccgcgccctcatcaactctgccatcggcaaggatgctaccgccata
ttcaacggcggtgtttaccttcactccaacgccgctcacaaccttctctccaccatgcgc
gtcggcgtcctccgtggcggctgcgaggtcgagatctggaagcgtgcccagttcgagaac
aaggacatgacctacgtcaccgactcatccggccagcgtattgttcgcgccggcgaccag
ctcactcgcgttgctcagcccaccaagggcgccgatgcggcgtaa

DBGET integrated database retrieval system