KEGG   Verticillium alfalfae: VDBG_04943Help
Entry
VDBG_04943        CDS       T02227                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
val  Verticillium alfalfae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_04943
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    VDBG_04943
   00603 Glycosphingolipid biosynthesis - globo series
    VDBG_04943
   00604 Glycosphingolipid biosynthesis - ganglio series
    VDBG_04943
   00511 Other glycan degradation
    VDBG_04943
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VDBG_04943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MHLSSILLTSLTLALTQASIWPAPKKLTTGNTTLFIDESLKITYNGDPVRWNSPSLHDTG
GAFAQDAETLLNMQLPYTYSYKPDTSCAWSSKAVIQGAVSRSLNSIFHQNFVPWMLHEKN
SQFEPDVHGSGQGRVKSLSITQNSKNDSESPYTSLAEDIDESYTLSLSEEGVAEIKAPTA
IGVLRALESFSQLFYSHTTGKIGAYRKGLSYTPEDIQYIHEYAVHRGVQVIVEIDMPGHT
GSIAFAYPELIVAYNQQPYQWWCAEPPCGAFKLNSTAVDSFLDKLFDDLLPRVAPYTAYF
HTGGDELNKNDSMLDEGVRSNSSQVLQPLLQRFMDKNHARVRKHGLVPMVWEEMATEWNI
TMGKDVVVQTWLGEPSIKQVTGLGHKVIDSNYNFWYLDCGRGHWLNFDNGAAFKAFYPFQ
DWCSPAKGWRLIYSHDPARA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacctctcatccatcctcctcacctccctcaccctggcccttacccaagccagcatc
tggcccgcccccaagaagctcacgacgggcaacacaacactcttcatagacgagtccttg
aagataacctacaatggtgaccctgtacgctggaactccccctccctccatgacaccggc
ggcgcctttgcgcaggatgctgagacccttttgaacatgcagctcccctacacgtacagc
tacaagccggacaccagctgcgcctggagcagcaaggctgtcatccagggcgccgtgtcg
cgctccctgaactccatcttccaccaaaactttgtgccctggatgctccacgagaagaac
agccagttcgagcctgatgtccacggtagtggccagggccgcgtcaagtcgttgagcatc
acacagaacagcaagaacgacagcgagagcccctacacatccttggccgaggatattgat
gagtcgtacaccttgagcctctctgaggaaggcgtcgccgagatcaaggcaccaaccgcc
attggcgtcctgcgcgcgctcgagtccttctcccagctcttctactcgcacacaaccggc
aagattggtgcctaccgcaagggtctctcatacacgcccgaagacatccagtacatccac
gagtatgccgttcacaggggcgttcaggtcatagtcgagattgacatgcccggtcacacg
ggctccatcgcctttgcgtacccagagcttatcgttgcgtacaaccaacagccatatcag
tggtggtgcgccgagccgccttgtggcgccttcaagttgaacagcaccgcagtcgacagt
tttctcgataagctctttgatgatctgctcccgcgcgtcgcgccatacacggcgtacttc
cacactggtggtgacgagctgaacaagaacgattccatgctggatgaaggtgtccgctcc
aactcgtctcaagtgctgcagcccctactgcagaggttcatggacaagaaccacgcgcgc
gtgcgtaagcatggcctcgtgccgatggtttgggaggagatggcaaccgaatggaacatc
accatgggcaaggacgttgtcgttcagacatggctcggtgaaccatcgatcaagcaagtg
acgggactaggccacaaggtcatcgacagcaactacaacttttggtacctcgactgcgga
cggggtcactggctcaactttgacaatggcgccgcgttcaaggcgttctatccgttccaa
gactggtgctcgcctgccaaaggctggcgattgatctattcgcacgacccagcgagggcc
tga

DBGET integrated database retrieval system