KEGG   Verticillium albo-atrum: VDBG_04944Help
Entry
VDBG_04944        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
val  Verticillium albo-atrum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:val00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 530 aa AA seqDB search
MLCNKALHRSHGITAAAAYTRVASRTLMTAAPRKSRPTCMAYGATSVSVFSARRRGLATH
ATSEPQNIAVIGGGITGLTTAHFLAKSVPVGTKITVYEASDRIGGWLDTQKVEFEQNGQK
SVVQFERGPRTLRSYARDTWKMDDLVLFTLLNDLDIMPSFRPGGTRYVRIDGNITAVTPK
NMIKLLWKPMLRGFWRMKRNRLGTFADRSDQRLPKDMSVGEFLRMAAGESRTVDQFASAV
LHGIWGGDIDRLSMQSVMPKPWHNYWLKEPLPHLAHLPAHELALVTQLLTEEVRDMVKLS
HQGALIAFPEGMGSIPKAIAKSLQDKPNVEIKLGQSISKVEFDSAARKVMLSTADGASPA
AYDKVISTINSKHLFRLAPKHLPAARPFDEPNGTKMFVLMKGTYAEEDAKAKVREILHDH
LGIDPDERCIMLARTNKDCIPQHHVGHRELMARADGELSAAFNGQLAVAGPSYSAVGVVG
SMRSGYDMATQVTDPGKGRGRRHGSRSLPRRREAASRRPARAAGGRQADP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcaacaaagccctccaccgcagccatggcatcaccgccgcagccgcgtacaca
cgcgtggcctctcggaccctgatgaccgctgcgccgcggaagtctcggccgacttgtatg
gcctacggtgctacgtcggtgagcgtcttttctgctcggcgacgtggcctcgcgacgcac
gccacaagcgagccgcaaaacatcgccgtcattggcggtggcattacaggcctgacgacg
gcacacttccttgccaagtcggtgcctgtcggcactaagatcaccgtctatgaggcgagt
gatcgcatcggtggctggctagacactcaaaaggtcgagtttgagcagaatggtcagaag
agcgtcgtgcagtttgagcgcggccctcgcactctgcggagctatgcccgggacacctgg
aaaatggatgacctggtgctcttcactctgctcaacgacctcgacatcatgcccagcttc
aggccaggcggcacgcgctatgtccgcattgatggcaacatcaccgccgtcacgccgaag
aacatgatcaagcttctctggaagcccatgctcaggggattctggcgtatgaagcgcaac
cgtctcggcaccttcgcggaccgctctgatcagcgtctccccaaggacatgtctgtcggc
gaattcctccgcatggcggcgggcgagtctcgcaccgtcgaccagttcgcctcggctgtg
ttgcacggtatatggggcggcgacattgaccggctgtccatgcagtctgtcatgcccaag
ccctggcacaactactggctgaaagagcctcttccgcacctagctcatcttcccgcgcat
gaactcgctctggtgacgcagcttctcaccgaagaggtccgcgacatggtcaagctgagc
caccaaggagcgttgatcgccttccccgagggcatgggttctattcccaaggcgatcgcc
aagagcctgcaggacaagcccaatgtcgagataaagctgggtcaatccatcagcaaggtg
gaattcgactcagctgcccgcaaggtcatgctctccactgccgatggggcctcgcccgcg
gcgtacgacaaggtcatctccaccatcaacagcaagcacctcttcaggcttgcgcccaag
cacctccccgctgctcgcccgtttgacgagccgaacggcaccaagatgttcgtgctcatg
aagggcacgtacgccgaggaggacgcgaaggccaaggtgcgcgagatcctccatgatcac
ctcggcatcgacccggatgagcggtgcatcatgctcgcgcgcaccaacaaggactgcatc
ccgcagcaccacgtcgggcaccgcgagctcatggcgcgcgccgacggcgagctgtcggct
gcgttcaacggccagcttgccgtggctgggccttcgtactcggcagtcggcgtcgtgggg
tcgatgcgctcggggtacgacatggccacgcaggtgacggaccctgggaaaggccgcggt
cggcgacacgggtctcgctcgcttccgaggagacgagaagctgcaagccgtcgaccggca
cgggctgcagggggtcggcaggctgatccctga

DBGET integrated database retrieval system