KEGG   Verticillium alfalfae: VDBG_05048Help
Entry
VDBG_05048        CDS       T02227                                 

Definition
clathrin heavy chain 1
Orthology
K04646  
clathrin heavy chain
Organism
val  Verticillium alfalfae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    VDBG_05048
Exosome [BR:val04147]
 Exosomal proteins
  Proteins found in most exosomes
   VDBG_05048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1655 aa AA seqDB search
MAALPIRFEELVQLKSVGVEDSSITFNSCTLESDAYVCIREQKGDASPEVVIVDLKNGNN
VTRRPIKADSAIMHWSRQVIALKAQSRTLQIFDLEQKQKLKSATMNEDVQYWKWVTETTL
GLVTESSVFHWDVYDPSQAAPVKIFERNANLSGCQIINYRTNVDNKWMVVVGIAQREGRI
VGAMQLYSKDRGISQAIEGHAAAFGTIRLEGAPADTKLFTFSVRTATGAKLHVVEVDHAE
SNPVFQKKAVDVYFPPEATNDFPVAMQVSQKYGVIFMVTKYGFIHVYDLESGSCIFMNRI
SSDTIFTTCPDRDSSGIVGINRKGQVLFVTIDDSNIISYLLQNPANTEMAIKMASRAGLP
GADDLYKRQFEQLFNNGSYMEAAKVAANSPRGFLRSAETIEKFKRLPQQPGSMSFILQYF
GMLLDKGALNEHETLELAQPVLAQNRMNLLEKWMKEGKLHSSERLGDLIRPHDINTALAV
YLKANVPQKVVAGFAETGQFDKILPYSQQAGYSPDYVQLLQHIVRINPEKGAEFATSLAN
HEGGSLVDIARVVDIFQSQGMIQQATAFLLDALKENSPEQGQLQTRLLEMNLMNAPQVAD
AILGNEMFSHFDKPRIASLCEQAGLSQKALELYEDPEAIKRVVVNIAGTPNFNQDWLNGF
FGKLSVEQSLDCLDAMMKHNIRQNLQAVVTIATKYSDLLGPVQLVDLFEKYKTAEGLFYY
LGSVVNLSEEPDVIFKYIESATKMGQFNEVERICRDNNFYNAEKVKNFLKEAKLQEQLPL
IIVCDRFNFVHDLVLYLYQNQQFQSIETYVQRVNPSRTPAVIGGLLDVDCDEGIIKNLLS
TVNPQSIPIDDLVQEVESRNRLKLLLPFLEQMLSAGMEQQAVYNALAKIYIDSNNNPEKF
LKENDKYDSLSVGKYCEKRDPNLAYIAYSKGQNDLELVNITNENSMYRAQARYLLERSDR
ELWDFVLSENNIHRRSVIDQVTSTAVPESTDPSKVSVAVAALLGNDLPLELIELLEKIVL
EPSPFSDNQNLQNLLLFTAAKADKSKVMDYIHKLDGYSAPDIANACIEVGLHEEAFEIYK
KTGDKGSAVNVLVDHVVSIDRAQAFAEEVDQPEVWSKVAKAQLDGVRVSDAIESYIKADD
PRNYEEVIETAVHAGKNEELVKYLRMARKTLREPPIDTALAFCYARLDQLSELEDFLRGT
NVANIEESGDKAYEEGFFEAAKIFFTSISNWAKLATTLVHEACVEKKEFRLAQICGLNLI
VDAEQLTTLVKQYERNGYFDELISLLEQGLGLERAHMGMFTELGIALSRYHPERLMEHLK
LFWSRVNMPKLIRACEEATLWPELVFCYYHYDEYDNAALAVIERPENSWEHHQFKEIIVK
VANLEIYYRAIKFYIEQHPSLLTDLLQVLTPRIDVNRVVKLFEKNDDLPLIKPFLLNVQT
QNKRTVNNAINDLLIEEEDYKTLRDSVENYDNYDPVDLAARLEKHDLIFFRQIAANIYRK
NKRWEKSIALSKQDKLYKDAIETAAISSKTDIVEDLLRYFVDIGSRECYVGMLYSCYDLI
RPDLVLEISWRHGLNDFTMPYMINMLCQQTKELATLKADNEARKAKDKEQEKDDTNTPIL
GGNRLMITAGPGGSQSPAPYGQTNGFAPQATGYGF
NT seq 4968 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccttccgatcagattcgaggagctcgttcagctcaagagcgtcggcgtggag
gactcgtccatcactttcaactcctgcacactcgaatcagatgcctatgtttgtatccga
gaacagaagggtgacgcctcgcccgaggtcgtcatcgtcgacctcaagaatggcaacaac
gtcacccgccgccccatcaaggccgacagtgccatcatgcactggtcacgacaagtcatc
gccctgaaagcgcaatccagaactctccagatcttcgatctcgagcagaagcagaagctc
aaatcggccacgatgaacgaggacgtccagtactggaagtgggtcaccgagaccacgctc
ggccttgtcaccgagtcgtcagtgttccactgggacgtttacgacccgagccaggccgcc
cccgtcaagatctttgagcgcaatgccaacctcagtggatgccaaatcatcaattaccgc
acaaatgtcgataacaaatggatggtcgtcgtcggtatcgcccagcgcgagggacgcatc
gtcggtgccatgcaactctactccaaagaccgtggtatcagccaagccatcgagggtcac
gctgctgccttcggcaccatccggttggagggtgccccagcagacacaaagctcttcaca
ttctccgtcaggacggcaaccggcgcgaagcttcacgttgtcgaagttgaccacgccgag
tcgaaccctgtcttccagaagaaggcggtcgatgtgtacttcccacctgaggcgaccaac
gatttccccgtcgctatgcaggtctcgcagaaatacggcgtcattttcatggttaccaag
tacggcttcatccacgtctacgatctcgagagcggctcttgcatcttcatgaaccgtatt
tcaagcgataccatcttcactacctgccctgacagggactcctccggcatcgtcgggatc
aaccgcaagggtcaggtactcttcgtgacgattgacgacagcaacatcatctcgtatctt
ctccagaaccctgccaacacggaaatggcgatcaagatggcatcgcgtgctggtttgccc
ggcgccgacgacctctacaagcgccaattcgagcagcttttcaacaacggtagctacatg
gaagccgccaaggtcgctgccaactcgccccgcggctttcttcgatccgccgagaccatc
gagaagttcaagcgcctgccccagcagcctggttcaatgtccttcattctacaatacttt
ggcatgctcctcgacaagggcgccctcaacgagcacgaaactcttgagctggcgcagccc
gtgcttgcccagaacaggatgaacctgctggagaagtggatgaaggagggcaagctgcac
agctccgagcgcctcggtgatctcatccgcccccacgatatcaacacggctttggcggtg
tacctgaaggccaacgtaccccaaaaggttgtcgctggcttcgccgaaacgggccagttc
gacaagatcctgccgtactcgcaacaggctggctactcaccagattacgtgcagttgctg
cagcacattgttcgcatcaaccccgagaagggcgccgagtttgccacctctctcgccaac
cacgagggcggctctcttgtagacattgcgcgggtggtggacatcttccagtcccagggc
atgatccagcaagctactgccttcctcttggatgctttgaaggagaacagcccggagcag
ggccagctgcagactcgtcttcttgagatgaacctgatgaacgcccctcaagtcgccgat
gccattcttggtaatgagatgttctcccacttcgacaagccgcgcatcgcctccctttgt
gagcaggccggcctttcgcagaaggctttggagctctacgaagaccccgaagccatcaag
cgcgtcgttgtcaacatcgcaggcacacccaacttcaatcaggattggctgaatggcttc
ttcggcaagctctccgtggaacagtcgctcgactgcctggatgccatgatgaagcacaac
attcgccagaacctgcaggccgtggtgacgattgccaccaagtacagcgacctcctggga
cctgttcaactggttgatctctttgagaagtataagacggccgagggtctcttctattac
cttggtagcgttgtcaacctctctgaggagcctgatgttatcttcaagtacatcgagtcc
gccaccaagatgggccagttcaatgaggtggagcgcatttgccgcgacaacaacttctac
aacgccgagaaggtcaagaacttcctcaaggaggccaagctccaggagcagctgcctctt
atcatcgtctgcgaccgtttcaactttgtccacgatctcgttctctacctgtaccagaac
cagcagttccagtccattgagacatatgtccagcgtgtcaatccttcgaggacccctgcc
gtcatcggtggtctccttgacgttgactgcgacgagggcatcatcaagaacctgctgtca
accgtcaacccgcagtcgattcccatcgacgacttggtgcaggaggtcgagtcgcgcaac
cgcctcaagcttctcctgcccttcctcgagcaaatgctctctgccggtatggagcagcaa
gccgtttacaacgcgctggccaagatctacattgactccaacaacaaccccgagaagttc
ctcaaggagaacgacaagtatgattccctgagtgtcggcaagtactgtgagaaacgcgac
cccaacctcgcctacattgcctactccaagggtcagaacgaccttgagctcgtcaacatc
accaatgagaactccatgtaccgtgctcaggcccgctacctgttggagaggtctgaccgt
gagctttgggactttgtcctcagcgagaacaacattcaccgccgctccgtgattgaccag
gttacctcgacggctgtacccgaatcgacggatcccagcaaggtttctgtggctgttgcc
gccctgcttggcaatgatctcccccttgagctcatcgagcttcttgagaaaattgttctc
gagccttcccccttcagcgacaaccagaacctgcagaaccttcttctgttcacggctgcc
aaggccgacaagagcaaggtcatggactacattcacaagctggatggctacagcgcgccc
gacatcgccaacgcctgtattgaggtcggattgcacgaggaggccttcgagatctacaag
aagactggcgataagggatcagctgtcaatgttctcgttgatcacgtcgttagcatcgac
cgggctcaggcctttgccgaggaagttgaccagccggaggtctggtccaaggttgctaag
gctcagcttgacggtgtccgtgtcagcgatgccattgagtcgtacatcaaggccgatgac
cccaggaactacgaggaggtcattgagactgctgtgcacgctggaaagaacgaggagctt
gttaagtacctccgcatggcgcgtaagaccctgcgcgagcctcctattgatacggccctt
gctttctgctacgctcgcctagatcagctcagcgagctagaggacttcctccgcggcact
aatgtggctaatattgaggagtctggagacaaggcctatgaagagggtttcttcgaagct
gctaagatcttcttcactagcatctcgaactgggctaagctcgctaccacgctagtacac
gaggcctgcgtggaaaagaaggagttccgtctcgcccagatctgcggtctcaacctgatt
gtcgatgctgagcagctcacaaccctcgtaaagcagtacgagcgcaatgggtactttgat
gagcttattagcttgttagagcagggtcttggcctcgagcgcgctcatatgggtatgttc
accgagcttggcattgcgttgtcccgctaccaccctgagcgcctcatggagcacctcaag
ctcttctggagccgtgtcaacatgcccaagttgatccgtgcgtgcgaggaggcaaccctc
tggcccgagctcgtcttctgctactaccactacgatgagtacgacaacgcggcacttgcc
gttattgagaggcccgagaactcgtgggagcaccaccagttcaaggagatcattgtcaag
gtggccaacctggagatctactaccgcgccatcaagttctacattgagcagcacccgtcg
ctcctcaccgatctcctccaggttctcactcctcgtattgatgtcaaccgtgttgtcaag
ctgttcgagaagaacgacgacctgcctctgatcaagcctttccttctcaacgttcagact
cagaacaagcgcaccgtcaacaacgccatcaacgacctgttgatcgaggaggaggactac
aagaccctccgcgattctgttgagaactacgacaactacgatcctgtcgatcttgccgcc
cgcctcgagaagcacgacttgatcttcttccgccagattgctgctaacatctaccgcaag
aacaagaggtgggagaagtcgatcgcgctgtccaagcaagacaagctgtacaaggacgcc
atcgagacggccgccatctctagcaaaaccgacattgtggaggatctgctgcgttacttc
gtcgacattggtagccgcgagtgctacgtcggcatgctgtactcttgctacgacctcatc
cgccctgacctcgtgcttgagatctcttggcgccacggcctcaacgacttcaccatgccg
tacatgatcaacatgctgtgccagcagaccaaggagctggcaacgctgaaggcggacaac
gaggcccgcaaggccaaggacaaggagcaggagaaggacgacacgaacacgcccattctc
ggcggcaaccgccttatgattactgccggtcccggcggcagccagtcgcccgcgccttac
ggccagaccaatggcttcgcccctcaagcgactggctacggcttctag

DBGET integrated database retrieval system