KEGG   Verticillium alfalfae: VDBG_05083Help
Entry
VDBG_05083        CDS       T02227                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
val  Verticillium alfalfae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VDBG_05083
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDBG_05083
  Amino acid metabolism
   00310 Lysine degradation
    VDBG_05083
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VDBG_05083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 139 aa AA seqDB search
MSTSAWLLQPRRVFVTPVVAQHRVPWGMVGIEQAIADMGKKARDGKLTIEDMAGGTFTIS
NGGVFGSLMGTPIINLPQTAVLGLHAIKDRPIAVNGKVEVRPMMYLALTYDHRLLDGREA
VQFLVKIKEYIEDPRRMLL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcagcgtggctgttgcaaccgagaagggtctttgtgacacccgtcgtggcg
caacacagagttccatggggcatggttggcattgaacaggcaattgccgacatgggcaag
aaggctcgtgacggcaagctcacgattgaggacatggctggtgggactttcactatcagc
aatggcggcgtttttggttccctcatgggaactcctatcattaaccttccccagactgcc
gttcttggtctccatgccattaaggatcgcccgattgctgtcaatggcaaggtcgaggtt
cgtcccatgatgtacctcgctctcacctacgaccatcgcctactcgacgggagggaggcc
gtgcagtttttggtgaagataaaggagtacattgaggatccaaggaggatgctgctgtaa

DBGET integrated database retrieval system