KEGG   Verticillium alfalfae: VDBG_05172Help
Entry
VDBG_05172        CDS       T02227                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
val  Verticillium alfalfae
Brite
Membrane trafficking [BR:val04131]
 Others
  Actin-binding proteins
   Others
    VDBG_05172
Cytoskeleton proteins [BR:val04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     VDBG_05172
Exosome [BR:val04147]
 Exosomal proteins
  Proteins found in most exosomes
   VDBG_05172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 57 aa AA seqDB search
MARAEDGTIYARKGREGIAIAKTNQAILIGHHGEAAVAGNASAAVQKLADYLIGLSY
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgccgaggacggcaccatctacgcgcgcaagggcagggagggcatcgccatt
gccaagacgaaccaggccatcctcatcggccaccacggcgaggccgccgtcgctggcaac
gcgagcgcggcggtgcagaagctagctgactacctcatcggcctcagctactaa

DBGET integrated database retrieval system