KEGG   Verticillium albo-atrum: VDBG_05172Help
Entry
VDBG_05172        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 57 aa AA seqDB search
MARAEDGTIYARKGREGIAIAKTNQAILIGHHGEAAVAGNASAAVQKLADYLIGLSY
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgccgaggacggcaccatctacgcgcgcaagggcagggagggcatcgccatt
gccaagacgaaccaggccatcctcatcggccaccacggcgaggccgccgtcgctggcaac
gcgagcgcggcggtgcagaagctagctgactacctcatcggcctcagctactaa

DBGET integrated database retrieval system