KEGG   Verticillium alfalfae: VDBG_05270Help
Entry
VDBG_05270        CDS       T02227                                 

Definition
(RefSeq) protein-arginine deiminase type-3
Organism
val  Verticillium alfalfae
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 582 aa AA seqDB search
MKSTLQTAALALACAPLTCALNVTILADTNRDGIIDAKTDAEKKAEWSETRGALFLPNIG
DADDHCHEKMFDIFSNLNHSLDLSVNTDILGNAIESCNDASDDTQRNPQYLAPILVLANC
KVSPSATGSVHVTNDLAAKKVRIFQKDGDAWKYIAANHIFTAQELRKGLSLDVEQFISTA
GDDDDVDGAQAYFVKQLQKHVADAGFSEPVTLMSNSDEVTTQDYFESGYASIPGPHGPVV
IRIVIRSAQWQLFPGVEAIDRLRSDTVGAVQQPLLASDSPTDSLGNLETIPPYTHNGKSY
PAGRIVMGAVKGVKPLIFPFLEAQEFQVPLLLDVSWLAPVQIDKFLHFLPADNERGWVLM
INDPNAGLELLARASRDGHGGLPAVSRPVLPTTFGCQVIETVDKVLGLAELEIITRNVTV
RIEDNIAILKRETGLSDDEIFRVPALFYPVDRPVFTCDEEAENTAPARGAPGPSLMRPCR
CGKREKGIRTQTGELRQKGSGRYYPNAINNIVLTANHTVLAPNPFGPVIDGVDIIAEAIT
AVYARANFKVTYLDDWFSHYINGADVHDGTNVWRDASMPWWG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacccttcaaacggcggcactcgccctcgcgtgcgctcctctcacgtgtgcc
ctgaacgtcaccatacttgcggataccaaccgggatggaatcatcgatgccaagacggat
gccgaaaagaaagccgagtggagtgagacgagaggtgctcttttcttgcccaacatcgga
gacgcggatgatcattgccacgaaaagatgttcgacatattttcaaacctcaatcatagc
ctcgatttgtcggtcaacaccgacatcctgggcaacgcgatcgagtcttgcaacgacgct
tcagacgatactcaacgcaacccacaatacctggctcccatcctggtcctcgcgaactgc
aaggtcagccccagtgcaacaggctctgtccacgtgacgaacgacctggccgccaagaag
gtccgcatcttccaaaaggatggcgacgcctggaaatacattgcagcaaatcacatattc
acggcacaggagctcaggaaaggcttgtcccttgacgtggagcagttcatatcaacagcc
ggtgatgacgatgacgttgacggcgcccaggcctactttgtaaaacaacttcagaagcac
gttgccgacgcagggttcagtgaacccgtcaccctcatgtccaacagcgatgaagtcacg
acgcaggactactttgagtcggggtacgccagtatccctggccctcacggtcccgtcgtg
atccgcatcgtgatccggtccgcccagtggcaactcttccctggtgtcgaggcaatcgat
cgcctgcgatcagacaccgtgggcgccgtgcagcaacctttgttggcgtcggacagcccc
actgactcgttggggaacctcgagaccatccccccctacacgcacaacggcaagtcgtac
cccgccggccgcatcgtcatgggcgccgtgaaaggcgtcaagccgctcatctttcccttc
ctcgaagcgcaggagttccaggtgcccctcctgctcgacgtgtcttggttggctcccgtc
caaatcgacaagttcctccacttcctgccggcggacaacgagcgcggctgggttctcatg
atcaacgatcccaacgccggcctcgagctcctcgcccgcgcctcacgcgacggccacggc
gggctgcccgccgtgtcccgaccagtactgcccaccaccttcggctgccaggtcattgag
acggtcgacaaggtgttgggcttggccgagttggagatcatcacacgcaacgtgacggtc
cgcatcgaggacaacatcgcgatcctcaagcgcgagacgggcctctcggacgacgaaatc
ttccgcgtgcccgccctgttctacccggtcgatcgcccggtcttcacctgcgatgaggag
gcagaaaacaccgcgcccgcccggggcgcgccgggtccatcattgatgcgtccctgccgc
tgcggaaaaagggaaaaaggaattcgtacgcagacaggagaacttcggcaaaaggggtct
ggacggtattacccgaatgccatcaacaacatcgtgctgacggcgaatcacacggtcctg
gcgcccaatccgttcggtcctgtcattgatggcgtggacataatcgccgaggccatcacg
gcagtgtacgcaagggccaacttcaaggtgacgtacttagacgactggttctctcattat
atcaacggcgcggacgtgcacgacggcaccaacgtgtggcgtgacgccagcatgccttgg
tggggatag

DBGET integrated database retrieval system