KEGG   Verticillium alfalfae: VDBG_05270Help
Entry
VDBG_05270        CDS       T02227                                 

Definition
protein-arginine deiminase type-3
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     VDBG_05270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 582 aa AA seqDB search
MKSTLQTAALALACAPLTCALNVTILADTNRDGIIDAKTDAEKKAEWSETRGALFLPNIG
DADDHCHEKMFDIFSNLNHSLDLSVNTDILGNAIESCNDASDDTQRNPQYLAPILVLANC
KVSPSATGSVHVTNDLAAKKVRIFQKDGDAWKYIAANHIFTAQELRKGLSLDVEQFISTA
GDDDDVDGAQAYFVKQLQKHVADAGFSEPVTLMSNSDEVTTQDYFESGYASIPGPHGPVV
IRIVIRSAQWQLFPGVEAIDRLRSDTVGAVQQPLLASDSPTDSLGNLETIPPYTHNGKSY
PAGRIVMGAVKGVKPLIFPFLEAQEFQVPLLLDVSWLAPVQIDKFLHFLPADNERGWVLM
INDPNAGLELLARASRDGHGGLPAVSRPVLPTTFGCQVIETVDKVLGLAELEIITRNVTV
RIEDNIAILKRETGLSDDEIFRVPALFYPVDRPVFTCDEEAENTAPARGAPGPSLMRPCR
CGKREKGIRTQTGELRQKGSGRYYPNAINNIVLTANHTVLAPNPFGPVIDGVDIIAEAIT
AVYARANFKVTYLDDWFSHYINGADVHDGTNVWRDASMPWWG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacccttcaaacggcggcactcgccctcgcgtgcgctcctctcacgtgtgcc
ctgaacgtcaccatacttgcggataccaaccgggatggaatcatcgatgccaagacggat
gccgaaaagaaagccgagtggagtgagacgagaggtgctcttttcttgcccaacatcgga
gacgcggatgatcattgccacgaaaagatgttcgacatattttcaaacctcaatcatagc
ctcgatttgtcggtcaacaccgacatcctgggcaacgcgatcgagtcttgcaacgacgct
tcagacgatactcaacgcaacccacaatacctggctcccatcctggtcctcgcgaactgc
aaggtcagccccagtgcaacaggctctgtccacgtgacgaacgacctggccgccaagaag
gtccgcatcttccaaaaggatggcgacgcctggaaatacattgcagcaaatcacatattc
acggcacaggagctcaggaaaggcttgtcccttgacgtggagcagttcatatcaacagcc
ggtgatgacgatgacgttgacggcgcccaggcctactttgtaaaacaacttcagaagcac
gttgccgacgcagggttcagtgaacccgtcaccctcatgtccaacagcgatgaagtcacg
acgcaggactactttgagtcggggtacgccagtatccctggccctcacggtcccgtcgtg
atccgcatcgtgatccggtccgcccagtggcaactcttccctggtgtcgaggcaatcgat
cgcctgcgatcagacaccgtgggcgccgtgcagcaacctttgttggcgtcggacagcccc
actgactcgttggggaacctcgagaccatccccccctacacgcacaacggcaagtcgtac
cccgccggccgcatcgtcatgggcgccgtgaaaggcgtcaagccgctcatctttcccttc
ctcgaagcgcaggagttccaggtgcccctcctgctcgacgtgtcttggttggctcccgtc
caaatcgacaagttcctccacttcctgccggcggacaacgagcgcggctgggttctcatg
atcaacgatcccaacgccggcctcgagctcctcgcccgcgcctcacgcgacggccacggc
gggctgcccgccgtgtcccgaccagtactgcccaccaccttcggctgccaggtcattgag
acggtcgacaaggtgttgggcttggccgagttggagatcatcacacgcaacgtgacggtc
cgcatcgaggacaacatcgcgatcctcaagcgcgagacgggcctctcggacgacgaaatc
ttccgcgtgcccgccctgttctacccggtcgatcgcccggtcttcacctgcgatgaggag
gcagaaaacaccgcgcccgcccggggcgcgccgggtccatcattgatgcgtccctgccgc
tgcggaaaaagggaaaaaggaattcgtacgcagacaggagaacttcggcaaaaggggtct
ggacggtattacccgaatgccatcaacaacatcgtgctgacggcgaatcacacggtcctg
gcgcccaatccgttcggtcctgtcattgatggcgtggacataatcgccgaggccatcacg
gcagtgtacgcaagggccaacttcaaggtgacgtacttagacgactggttctctcattat
atcaacggcgcggacgtgcacgacggcaccaacgtgtggcgtgacgccagcatgccttgg
tggggatag

DBGET integrated database retrieval system