KEGG   Verticillium alfalfae: VDBG_05284Help
Entry
VDBG_05284        CDS       T02227                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
val  Verticillium alfalfae
Pathway
val00010  Glycolysis / Gluconeogenesis
val00052  Galactose metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
Module
val_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDBG_05284
   00052 Galactose metabolism
    VDBG_05284
Enzymes [BR:val01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VDBG_05284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9531150
NCBI-ProteinID: XP_003004171
UniProt: C9SKF7
AA seq 410 aa AA seqDB search
MILPTSSLAAVACVLPFVLGTPLSYATTNTTNTTTPGPDADGKYWISSEHLRAAFVPYGA
SISDLIVRDRNGVPRDIVAGWDNATYYTEDPVHPNFGNVPGRYANRIRNSTFDIDGETFH
VKPNDNKTPEHPEGLNTLHGGPDGWGWRNFTVAAHTKNSITFSLVDPAGKEGFPGEVISY
VTYTLRGWDWDISMVAVSTTARTPIMLSSHTYWNLDGFANEETSSADDHVLHLPYSGQRI
GVDGILIPTGEVLANEKGSVNDFWSAPKPMGANATSDELEGNCGTGCTGYDNCYTVNREA
LGNYDWQSSGYVARLSSPWSGIAVEVFSEQEALQVYSCTQQDGTIPLKKTQGTDAFPRII
PRYGCVVLEVQDWIDGINHPEWGREKRQVFGPEDGPYVLQARYSFSVDKA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatccttcccacaagctcccttgcggcggtggcctgtgtccttccgttcgttctgggc
actcccctctcgtacgcgacgaccaacacaaccaacactacgacccccggtcctgatgcc
gacggcaagtactggatctccagcgaacacctccgcgccgcctttgtcccctacggcgct
tccatatcagacctcatcgtccgcgatcgtaatggcgtgcctcgggacatcgtcgccggc
tgggataacgcgacgtactacacagaggatcccgtgcacccaaactttggcaatgttccc
ggccgctacgccaaccgaatccgcaatagcacgtttgatattgacggcgagacgttccat
gtgaagcccaacgacaacaagacacccgaacaccccgagggtctcaacacgctgcacggc
ggacccgatgggtggggctggcgcaacttcactgtcgccgcgcacaccaagaacagcatc
accttctcgctcgtcgacccggctggcaaagagggcttccccggcgaggtcatctcgtac
gtgacgtacaccctgcgcggctgggactgggacatctccatggtggccgtgtcgaccacg
gcgcgcacgcccatcatgttgagcagccacacgtactggaacctcgacgggttcgccaac
gaggagaccagctcggccgacgaccacgtcctgcacctgccctacagcgggcagcggatc
ggggtcgacggcatcctcatccccacgggcgaggtgctcgccaacgaaaaggggtccgtt
aatgacttttggtctgcgccgaagcccatgggcgccaacgccacgagcgacgagctcgag
ggcaactgcggcaccggttgcacgggctatgacaactgctacaccgtcaaccgcgaggcg
ctcgggaactacgactggcagtcttcgggctacgtcgcccgcttgtcgtcgccgtggtct
ggcatcgccgtcgaggtcttctcggagcaggaagcgctgcaggtgtatagctgcacgcag
caggacggaacgatccctctcaagaagacgcagggcaccgacgccttcccgcgcatcatc
ccgcggtacggctgcgtcgttcttgaggtgcaggattggattgacggtatcaaccacccc
gagtggggaagggagaagaggcaagtatttggcccggaggatgggccctatgtcctccag
gcgcggtactcctttagcgtggacaaggcgtga

DBGET integrated database retrieval system