KEGG   Verticillium alfalfae: VDBG_05423Help
Entry
VDBG_05423        CDS       T02227                                 

Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
val  Verticillium alfalfae
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    VDBG_05423
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     VDBG_05423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 399 aa AA seqDB search
MYEPTSKEWTDVYLNEAISLLLIATCPLFLLFYWITYQDFGVSISSSAEALISDGILNFL
ARCPRPTIASTTTYAAWVLSQAALYHALPGPLHRGPRTPGGRQLLYRLNGFYAWILTIGI
TAVATFCRLIDPTYIARHWGDLLATANVYCVALIVIFYVKARLKPDNAGETLLTGHFWYD
LFNGGELHPRTGVLFDWKHFNASRTGGLLLWTLMFFETLDGAHERFSFYSIYGFAAIMPQ
IWTLQTQYLVRYPVDLSNAMAIAVTTAFAAGWALNHDANRQKSKCRETAGNYLIWGKEAQ
FLEATYQTADGKKHRTVLLHSGWWGIVRHANYVGSLLYTWASCAACGAGHFFPYTEALLV
TATVIHRCFRDEARCKEKYGDTWDEYCRIVKWRMIPGIF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaccaacatcgaaagagtggaccgatgtctatctgaacgaagcaattagtctt
ctacttatcgccacgtgccccttatttctcctcttttactggatcacgtaccaggatttt
ggcgtttcgatttcatcaagcgcagaagctttgatctctgacggtatacttaacttccta
gcgcgctgtccacgtccaacaatagcctctaccacgacgtatgcggcctgggtcctttcg
caagcagctctgtatcacgccctgcctggtccgcttcatcgggggccacgaactcccggg
ggaagacaactgttgtacaggttaaatggattttatgcctggattcttaccattggcatc
actgcagtggcgacattttgcaggctgattgacccaacgtatatcgccagacactggggt
gatcttcttgcaaccgcaaatgtgtactgtgttgcacttatcgttattttttacgtcaag
gctcgtcttaagccagataacgccggcgagacattactcacaggtcatttctggtatgac
ttgttcaatggaggggagctccatccccgaacgggggtcttgtttgattggaagcacttc
aatgccagtcgaacgggaggacttttgctctggaccttaatgttctttgaaacactggat
ggggcgcatgagcgtttctctttttacagcatttatggctttgctgccattatgccacaa
atctggacactccaaactcagtatcttgtccgctacccggtagacctgtccaacgcgatg
gccatagccgtgaccactgccttcgctgcggggtgggccctgaatcacgatgcaaatcgt
cagaaaagcaaatgccgagaaacggctggtaattacctcatctgggggaaggaggctcag
ttccttgaagcaacttatcagacggcggacgggaagaaacaccgcaccgtcttattacac
tcaggatggtggggaatagtgcgtcacgccaactacgtcggaagcctcctatatacttgg
gcctcttgcgcggcttgtggagctggacacttcttcccatacaccgaagcacttcttgtg
acggctacggttatacaccgttgcttccgtgacgaagcgaggtgtaaggagaagtacggg
gacacgtgggatgagtactgcaggattgtgaagtggagaatgattccaggaatattttag

DBGET integrated database retrieval system