KEGG   Verticillium alfalfae: VDBG_05423Help
Entry
VDBG_05423        CDS       T02227                                 

Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
val  Verticillium alfalfae
Pathway
val00100  Steroid biosynthesis
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    VDBG_05423
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     VDBG_05423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 Peptidase_A22B DUF1295
Motif
Other DBs
NCBI-GeneID: 9531294
NCBI-ProteinID: XP_003004310
UniProt: C9SKU6
AA seq 399 aa AA seqDB search
MYEPTSKEWTDVYLNEAISLLLIATCPLFLLFYWITYQDFGVSISSSAEALISDGILNFL
ARCPRPTIASTTTYAAWVLSQAALYHALPGPLHRGPRTPGGRQLLYRLNGFYAWILTIGI
TAVATFCRLIDPTYIARHWGDLLATANVYCVALIVIFYVKARLKPDNAGETLLTGHFWYD
LFNGGELHPRTGVLFDWKHFNASRTGGLLLWTLMFFETLDGAHERFSFYSIYGFAAIMPQ
IWTLQTQYLVRYPVDLSNAMAIAVTTAFAAGWALNHDANRQKSKCRETAGNYLIWGKEAQ
FLEATYQTADGKKHRTVLLHSGWWGIVRHANYVGSLLYTWASCAACGAGHFFPYTEALLV
TATVIHRCFRDEARCKEKYGDTWDEYCRIVKWRMIPGIF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaccaacatcgaaagagtggaccgatgtctatctgaacgaagcaattagtctt
ctacttatcgccacgtgccccttatttctcctcttttactggatcacgtaccaggatttt
ggcgtttcgatttcatcaagcgcagaagctttgatctctgacggtatacttaacttccta
gcgcgctgtccacgtccaacaatagcctctaccacgacgtatgcggcctgggtcctttcg
caagcagctctgtatcacgccctgcctggtccgcttcatcgggggccacgaactcccggg
ggaagacaactgttgtacaggttaaatggattttatgcctggattcttaccattggcatc
actgcagtggcgacattttgcaggctgattgacccaacgtatatcgccagacactggggt
gatcttcttgcaaccgcaaatgtgtactgtgttgcacttatcgttattttttacgtcaag
gctcgtcttaagccagataacgccggcgagacattactcacaggtcatttctggtatgac
ttgttcaatggaggggagctccatccccgaacgggggtcttgtttgattggaagcacttc
aatgccagtcgaacgggaggacttttgctctggaccttaatgttctttgaaacactggat
ggggcgcatgagcgtttctctttttacagcatttatggctttgctgccattatgccacaa
atctggacactccaaactcagtatcttgtccgctacccggtagacctgtccaacgcgatg
gccatagccgtgaccactgccttcgctgcggggtgggccctgaatcacgatgcaaatcgt
cagaaaagcaaatgccgagaaacggctggtaattacctcatctgggggaaggaggctcag
ttccttgaagcaacttatcagacggcggacgggaagaaacaccgcaccgtcttattacac
tcaggatggtggggaatagtgcgtcacgccaactacgtcggaagcctcctatatacttgg
gcctcttgcgcggcttgtggagctggacacttcttcccatacaccgaagcacttcttgtg
acggctacggttatacaccgttgcttccgtgacgaagcgaggtgtaaggagaagtacggg
gacacgtgggatgagtactgcaggattgtgaagtggagaatgattccaggaatattttag

DBGET integrated database retrieval system