KEGG   Verticillium albo-atrum: VDBG_05527Help
Entry
VDBG_05527        CDS       T02227                                 

Definition
bifunctional P-450:NADPH-P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
val  Verticillium albo-atrum
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:val00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:val00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1092 aa AA seqDB search
MAEETPIPEPQGLPLIGNVKEMDPDFPLGSMTSMADRFGEIYRLRFPGRTVVLVSTQKLV
NETCDEKRFKKSVNSSLNQVRNGVHDGLFTAKMGEENWGIAHRILMPAFGPLSIRNMFDE
MHDIASQLTLKWARYGPDTPIMVTDDFTRLTLDTLALCSMGFRFNSFYSPVLHPFIESMG
DFLVECGHRANRLPLPSLFYRARDQKFDADISVLRTTAKEVLESRKAGKSDRRDLLTAML
EGVDSKTGKKMSDESIMDNLITFLIAGHETTSGLLSFAFLELLKHPESYQKAQKEVDDVC
GKGTIKVEHMAKLPYISAVLRETLRLNATIPLFTVEAFEDTLLGGKYPVKQGETIVNLLA
KSQLDPLVFGETANDFVPERMLDAEFDRLNKEFPNCWKPFGNGMRACIGRPFAWQEALLV
MAMLLQNFNFILDPTYHKHLKQTLTIKPKDMHMRAVLRDGLTPTTLERRLAGLAVQPEAT
KETEEIQGSSATGEGLPLTVLYGSNSGTCEALAHRVASDAASHGFRATKVDCLDSANQTL
PTDQPVVIVTASYEGNPPDNAGHFVAWVEGMKKDEAPLKNVNYVVFGCGNRDWVQTFHRI
PKLVDTQMEAMGGTRLAEMGLTDVSTGEVFTEFETWEDDVLWPALESKYKTETKSDAAPT
HKVKGMNVEITNPRTSTLRQDVKDATVVDARVLTQADGEQQEVKKHLEIKLPEGLSYKSG
DYLAVLPINPKETVHRAMRCLQLPRDAHLSITTDGPTSLPVNESVPAYDLLSSYVELGQP
ATKRNLLALAEAVSDDKTKAEITRLSGDAYAEEISSKRVSVLDILERFPSAQLPVGLFLS
MLPPMRVRQKTARMRPQKSDHALTARSSISSSPMWNPEHATITFSVLNAPSLSGSGQQYM
GVASTYLDSLAPGDVLHVGIRTPSTAFRLPSDAENTPVVCIAAGTGLAPFRAFAQERASM
IAAGRRLAPALLFFGCRSRAHDDLYRDELEQWEKLGAVSVRRAYSREAEASEGCRHVQDR
MWHDRDEIVALWRKQAKVFVCGSRGVANSARDMAIKLRMEMDKQKGAEVDEKSAAEWIES
LRNVRYVMDVFD
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaacacctatacctgagccccagggcctaccgctcattggcaacgtcaag
gagatggaccccgatttcccattgggatcgatgacatcaatggccgaccgatttggtgaa
atttaccgattgaggttccctggcaggacagtcgtcctggtgtccacccagaagctcgtc
aacgagacgtgcgatgagaagcgattcaagaagtcggtcaactcatcattaaatcaagta
agaaacggtgttcacgatggtttattcacagcgaaaatgggagaggagaactgggggatc
gcccacaggattttgatgcccgcattcgggcccctttccattcgcaacatgttcgacgag
atgcacgacattgcctctcagctcaccctcaaatgggcccgttatggccccgacacgccc
atcatggtcactgacgatttcacgcgactgacgctcgataccctggcactatgctctatg
ggcttccgtttcaacagtttctattctccggtcttgcaccctttcatcgagtccatgggt
gattttttggtcgagtgcggccaccgcgcgaacaggctaccgctgccgtcgctcttctac
cgcgccagggatcaaaagtttgatgctgacattagtgtcctgcggacaaccgccaaggag
gtcctcgagtcgcgtaaagccggcaagagtgatcgtcgtgatctgctgacggccatgcta
gaaggtgttgactccaaaactggcaagaaaatgtcagacgagagcatcatggataacctc
atcacgttcctgatcgccggccacgaaaccacgtctggtctcctgtcatttgccttcctc
gagctgctgaagcatccagagtcctatcagaaggctcagaaagaagtcgacgatgtttgc
gggaagggcacaatcaaggttgagcacatggcaaaactaccgtatatttcggccgttctc
cgcgagactcttcgtctcaacgccacgattcccctattcacggtcgaggccttcgaagat
accctgctcggcggaaaatatcctgtgaagcagggcgagaccatcgtcaacctgcttgcc
aagtctcagctcgacccgctcgtctttggcgagacggccaacgattttgtccctgagcgc
atgcttgacgccgagttcgaccgcctcaacaaggagttccccaactgctggaagccgttt
ggaaacggcatgagggcctgcatcggccgtcctttcgcctggcaggaggcccttctggtc
atggccatgctcctgcagaacttcaacttcatcctcgacccaacctatcacaagcacctc
aaacagactctaactatcaagcccaaggatatgcacatgcgcgccgtcctccgcgacggt
ctgactcccacgacactcgagcgccgtcttgccggcctcgccgtgcagcccgaagctacg
aaggagaccgaggaaattcaaggctcgagcgccacgggcgagggtctccccctcaccgtc
ctctacggctccaacagcggcacgtgcgaggcgctcgctcaccgagtggcttccgacgcg
gcatcacacggcttccgcgctacaaaggtggactgtctcgacagtgctaaccagacgctg
ccgactgatcagcccgtggtcattgtcacggcttcatacgaaggcaaccctccagacaac
gccggccactttgttgcctgggttgagggtatgaaaaaggacgaggcacctctgaagaac
gttaactacgtcgtctttggctgcggcaaccgtgactgggtgcagacattccatcgtatt
ccgaagttggtcgacacccagatggaagcgatgggcggaacccgtcttgcggaaatgggt
ctcacggacgtgtccacgggcgaggtttttaccgaattcgagacgtgggaagatgacgtc
ctctggcccgctctggaaagcaagtacaagactgaaactaagagcgatgcggcgccgact
cacaaggtcaagggtatgaacgttgagatcacaaacccccggacctcgactctccgccag
gacgtcaaggatgccactgttgtcgatgcgcgagtcctcacccaggcagacggcgagcag
caggaggtgaagaagcacttggaaatcaagctgcccgagggtctgagctataagtctggc
gactacctcgcggtgctgcccatcaaccccaaggaaaccgtgcacagggcgatgcgatgc
cttcagctgccccgagacgctcatttgagcatcacaaccgatgggccgacctcacttcct
gtcaacgagagcgtgccggcctatgacctgctgagttcctacgtcgagctgggccagcct
gctaccaagagaaaccttctcgcgcttgctgaggctgtcagtgacgacaagaccaaggca
gagatcacccgcctgtccggtgatgcctacgccgaagagatcagcagcaagcgagtgtcc
gtcctcgacattctcgagcgtttccccagcgcgcagctgcccgttggtctgttcctatca
atgctgcctcccatgcgtgtgcgacaaaaaacggcacgaatgcgtccgcagaagtccgat
cacgcgctgacagctcgcagctccatttcgtcctcccccatgtggaacccggagcacgca
accatcaccttctccgtgctcaacgcgccctccctctcagggtctggccagcagtacatg
ggcgtggcctcgacgtacctcgactccctcgcgccgggcgacgtgcttcacgtcggcatc
cgcacgccgagcacggccttccgcctgccctcggacgccgagaacacgcccgtcgtctgc
atcgccgcgggcacgggcctcgcgcccttccgcgccttcgcccaggagcgcgccagcatg
atcgccgccggccgccggctggcgcctgcgctgctgttcttcgggtgccgctcgcgggcg
cacgacgacctgtaccgcgacgagctggagcagtgggagaagctcggcgccgtgagcgtc
cggcgggcatacagccgcgaggccgaggccagcgaggggtgcaggcacgtgcaggatcgc
atgtggcatgaccgggacgagattgtggcgctctggaggaagcaggccaaggtttttgtc
tgtggctccaggggggtggccaactcggcgagggacatggcgatcaagctgaggatggaa
atggacaagcaaaagggtgccgaggtggatgaaaagagcgccgcggagtggattgagtcg
ttgaggaacgtgcgatatgttatggatgtctttgactga

DBGET integrated database retrieval system