KEGG   Verticillium alfalfae: VDBG_05527Help
Entry
VDBG_05527        CDS       T02227                                 

Definition
bifunctional P-450:NADPH-P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
val  Verticillium alfalfae
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    VDBG_05527
  Amino acid metabolism
   00380 Tryptophan metabolism
    VDBG_05527
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     VDBG_05527
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     VDBG_05527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1092 aa AA seqDB search
MAEETPIPEPQGLPLIGNVKEMDPDFPLGSMTSMADRFGEIYRLRFPGRTVVLVSTQKLV
NETCDEKRFKKSVNSSLNQVRNGVHDGLFTAKMGEENWGIAHRILMPAFGPLSIRNMFDE
MHDIASQLTLKWARYGPDTPIMVTDDFTRLTLDTLALCSMGFRFNSFYSPVLHPFIESMG
DFLVECGHRANRLPLPSLFYRARDQKFDADISVLRTTAKEVLESRKAGKSDRRDLLTAML
EGVDSKTGKKMSDESIMDNLITFLIAGHETTSGLLSFAFLELLKHPESYQKAQKEVDDVC
GKGTIKVEHMAKLPYISAVLRETLRLNATIPLFTVEAFEDTLLGGKYPVKQGETIVNLLA
KSQLDPLVFGETANDFVPERMLDAEFDRLNKEFPNCWKPFGNGMRACIGRPFAWQEALLV
MAMLLQNFNFILDPTYHKHLKQTLTIKPKDMHMRAVLRDGLTPTTLERRLAGLAVQPEAT
KETEEIQGSSATGEGLPLTVLYGSNSGTCEALAHRVASDAASHGFRATKVDCLDSANQTL
PTDQPVVIVTASYEGNPPDNAGHFVAWVEGMKKDEAPLKNVNYVVFGCGNRDWVQTFHRI
PKLVDTQMEAMGGTRLAEMGLTDVSTGEVFTEFETWEDDVLWPALESKYKTETKSDAAPT
HKVKGMNVEITNPRTSTLRQDVKDATVVDARVLTQADGEQQEVKKHLEIKLPEGLSYKSG
DYLAVLPINPKETVHRAMRCLQLPRDAHLSITTDGPTSLPVNESVPAYDLLSSYVELGQP
ATKRNLLALAEAVSDDKTKAEITRLSGDAYAEEISSKRVSVLDILERFPSAQLPVGLFLS
MLPPMRVRQKTARMRPQKSDHALTARSSISSSPMWNPEHATITFSVLNAPSLSGSGQQYM
GVASTYLDSLAPGDVLHVGIRTPSTAFRLPSDAENTPVVCIAAGTGLAPFRAFAQERASM
IAAGRRLAPALLFFGCRSRAHDDLYRDELEQWEKLGAVSVRRAYSREAEASEGCRHVQDR
MWHDRDEIVALWRKQAKVFVCGSRGVANSARDMAIKLRMEMDKQKGAEVDEKSAAEWIES
LRNVRYVMDVFD
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaacacctatacctgagccccagggcctaccgctcattggcaacgtcaag
gagatggaccccgatttcccattgggatcgatgacatcaatggccgaccgatttggtgaa
atttaccgattgaggttccctggcaggacagtcgtcctggtgtccacccagaagctcgtc
aacgagacgtgcgatgagaagcgattcaagaagtcggtcaactcatcattaaatcaagta
agaaacggtgttcacgatggtttattcacagcgaaaatgggagaggagaactgggggatc
gcccacaggattttgatgcccgcattcgggcccctttccattcgcaacatgttcgacgag
atgcacgacattgcctctcagctcaccctcaaatgggcccgttatggccccgacacgccc
atcatggtcactgacgatttcacgcgactgacgctcgataccctggcactatgctctatg
ggcttccgtttcaacagtttctattctccggtcttgcaccctttcatcgagtccatgggt
gattttttggtcgagtgcggccaccgcgcgaacaggctaccgctgccgtcgctcttctac
cgcgccagggatcaaaagtttgatgctgacattagtgtcctgcggacaaccgccaaggag
gtcctcgagtcgcgtaaagccggcaagagtgatcgtcgtgatctgctgacggccatgcta
gaaggtgttgactccaaaactggcaagaaaatgtcagacgagagcatcatggataacctc
atcacgttcctgatcgccggccacgaaaccacgtctggtctcctgtcatttgccttcctc
gagctgctgaagcatccagagtcctatcagaaggctcagaaagaagtcgacgatgtttgc
gggaagggcacaatcaaggttgagcacatggcaaaactaccgtatatttcggccgttctc
cgcgagactcttcgtctcaacgccacgattcccctattcacggtcgaggccttcgaagat
accctgctcggcggaaaatatcctgtgaagcagggcgagaccatcgtcaacctgcttgcc
aagtctcagctcgacccgctcgtctttggcgagacggccaacgattttgtccctgagcgc
atgcttgacgccgagttcgaccgcctcaacaaggagttccccaactgctggaagccgttt
ggaaacggcatgagggcctgcatcggccgtcctttcgcctggcaggaggcccttctggtc
atggccatgctcctgcagaacttcaacttcatcctcgacccaacctatcacaagcacctc
aaacagactctaactatcaagcccaaggatatgcacatgcgcgccgtcctccgcgacggt
ctgactcccacgacactcgagcgccgtcttgccggcctcgccgtgcagcccgaagctacg
aaggagaccgaggaaattcaaggctcgagcgccacgggcgagggtctccccctcaccgtc
ctctacggctccaacagcggcacgtgcgaggcgctcgctcaccgagtggcttccgacgcg
gcatcacacggcttccgcgctacaaaggtggactgtctcgacagtgctaaccagacgctg
ccgactgatcagcccgtggtcattgtcacggcttcatacgaaggcaaccctccagacaac
gccggccactttgttgcctgggttgagggtatgaaaaaggacgaggcacctctgaagaac
gttaactacgtcgtctttggctgcggcaaccgtgactgggtgcagacattccatcgtatt
ccgaagttggtcgacacccagatggaagcgatgggcggaacccgtcttgcggaaatgggt
ctcacggacgtgtccacgggcgaggtttttaccgaattcgagacgtgggaagatgacgtc
ctctggcccgctctggaaagcaagtacaagactgaaactaagagcgatgcggcgccgact
cacaaggtcaagggtatgaacgttgagatcacaaacccccggacctcgactctccgccag
gacgtcaaggatgccactgttgtcgatgcgcgagtcctcacccaggcagacggcgagcag
caggaggtgaagaagcacttggaaatcaagctgcccgagggtctgagctataagtctggc
gactacctcgcggtgctgcccatcaaccccaaggaaaccgtgcacagggcgatgcgatgc
cttcagctgccccgagacgctcatttgagcatcacaaccgatgggccgacctcacttcct
gtcaacgagagcgtgccggcctatgacctgctgagttcctacgtcgagctgggccagcct
gctaccaagagaaaccttctcgcgcttgctgaggctgtcagtgacgacaagaccaaggca
gagatcacccgcctgtccggtgatgcctacgccgaagagatcagcagcaagcgagtgtcc
gtcctcgacattctcgagcgtttccccagcgcgcagctgcccgttggtctgttcctatca
atgctgcctcccatgcgtgtgcgacaaaaaacggcacgaatgcgtccgcagaagtccgat
cacgcgctgacagctcgcagctccatttcgtcctcccccatgtggaacccggagcacgca
accatcaccttctccgtgctcaacgcgccctccctctcagggtctggccagcagtacatg
ggcgtggcctcgacgtacctcgactccctcgcgccgggcgacgtgcttcacgtcggcatc
cgcacgccgagcacggccttccgcctgccctcggacgccgagaacacgcccgtcgtctgc
atcgccgcgggcacgggcctcgcgcccttccgcgccttcgcccaggagcgcgccagcatg
atcgccgccggccgccggctggcgcctgcgctgctgttcttcgggtgccgctcgcgggcg
cacgacgacctgtaccgcgacgagctggagcagtgggagaagctcggcgccgtgagcgtc
cggcgggcatacagccgcgaggccgaggccagcgaggggtgcaggcacgtgcaggatcgc
atgtggcatgaccgggacgagattgtggcgctctggaggaagcaggccaaggtttttgtc
tgtggctccaggggggtggccaactcggcgagggacatggcgatcaagctgaggatggaa
atggacaagcaaaagggtgccgaggtggatgaaaagagcgccgcggagtggattgagtcg
ttgaggaacgtgcgatatgttatggatgtctttgactga

DBGET integrated database retrieval system