KEGG   Verticillium albo-atrum: VDBG_05542Help
Entry
VDBG_05542        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
val  Verticillium albo-atrum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_05542
   00240 Pyrimidine metabolism
    VDBG_05542
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VDBG_05542
   03410 Base excision repair
    VDBG_05542
   03420 Nucleotide excision repair
    VDBG_05542
   03430 Mismatch repair
    VDBG_05542
   03440 Homologous recombination
    VDBG_05542
DNA repair and recombination proteins [BR:val03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      VDBG_05542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 193 aa AA seqDB search
MPTNRRSTGGARARPGPNKGQSTISFSNKVSKPVPRQELKKAAVTKGDRIVTHAKKEEEV
PEAVEIEVEPEVEQPEPKVEVPQKTEVQIRAEKTTDAQINKYWRNIEAERIAKRVHVEDL
STGEKVLRYFDVSSQYGPCVGIQRMRRWERANKLGLNPPIEVLAVLLKEQKEGSQSERAH
MDAILNSTAVGST
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaaaccgcagatcaactggcggcgctcgcgcccgccctggacccaacaaaggt
caatcgaccatcagcttctccaacaaggtttcaaagcctgtacctcggcaggaactgaag
aaagccgctgtcaccaagggcgaccgcattgttacacatgccaaaaaggaggaggaggtt
cctgaggccgtcgagatcgaggtcgaacctgaggtagagcagccggagccaaaggtcgag
gtgccacagaagaccgaggtccagatccgcgccgagaagacgaccgatgcgcagatcaac
aagtactggcggaacattgaggcggagcgcattgccaagagggtgcatgtggaagacttg
agcacgggggagaaggtgctgcggtatttcgacgtcagctcgcagtacgggccctgtgtc
ggaatccaacggatgaggcgctgggagagggccaacaagctcggcctcaaccctcccatc
gaggttcttgccgtgctgctcaaggagcagaaggagggcagccaatctgagcgcgcgcat
atggatgcgattctcaactccacagcagtcgggtcaacatga

DBGET integrated database retrieval system