KEGG   Verticillium alfalfae: VDBG_05542Help
Entry
VDBG_05542        CDS       T02227                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
val  Verticillium alfalfae
Pathway
val00230  Purine metabolism
val00240  Pyrimidine metabolism
val01100  Metabolic pathways
val03030  DNA replication
val03410  Base excision repair
val03420  Nucleotide excision repair
val03430  Mismatch repair
val03440  Homologous recombination
Module
val_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_05542
   00240 Pyrimidine metabolism
    VDBG_05542
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VDBG_05542
   03410 Base excision repair
    VDBG_05542
   03420 Nucleotide excision repair
    VDBG_05542
   03430 Mismatch repair
    VDBG_05542
   03440 Homologous recombination
    VDBG_05542
DNA replication proteins [BR:val03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    VDBG_05542
DNA repair and recombination proteins [BR:val03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      VDBG_05542
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     VDBG_05542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 9531418
NCBI-ProteinID: XP_003004429
UniProt: C9SL65
AA seq 193 aa AA seqDB search
MPTNRRSTGGARARPGPNKGQSTISFSNKVSKPVPRQELKKAAVTKGDRIVTHAKKEEEV
PEAVEIEVEPEVEQPEPKVEVPQKTEVQIRAEKTTDAQINKYWRNIEAERIAKRVHVEDL
STGEKVLRYFDVSSQYGPCVGIQRMRRWERANKLGLNPPIEVLAVLLKEQKEGSQSERAH
MDAILNSTAVGST
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaaaccgcagatcaactggcggcgctcgcgcccgccctggacccaacaaaggt
caatcgaccatcagcttctccaacaaggtttcaaagcctgtacctcggcaggaactgaag
aaagccgctgtcaccaagggcgaccgcattgttacacatgccaaaaaggaggaggaggtt
cctgaggccgtcgagatcgaggtcgaacctgaggtagagcagccggagccaaaggtcgag
gtgccacagaagaccgaggtccagatccgcgccgagaagacgaccgatgcgcagatcaac
aagtactggcggaacattgaggcggagcgcattgccaagagggtgcatgtggaagacttg
agcacgggggagaaggtgctgcggtatttcgacgtcagctcgcagtacgggccctgtgtc
ggaatccaacggatgaggcgctgggagagggccaacaagctcggcctcaaccctcccatc
gaggttcttgccgtgctgctcaaggagcagaaggagggcagccaatctgagcgcgcgcat
atggatgcgattctcaactccacagcagtcgggtcaacatga

DBGET integrated database retrieval system