KEGG   Verticillium alfalfae: VDBG_05542Help
Entry
VDBG_05542        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
val  Verticillium alfalfae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_05542
   00240 Pyrimidine metabolism
    VDBG_05542
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VDBG_05542
   03410 Base excision repair
    VDBG_05542
   03420 Nucleotide excision repair
    VDBG_05542
   03430 Mismatch repair
    VDBG_05542
   03440 Homologous recombination
    VDBG_05542
DNA repair and recombination proteins [BR:val03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      VDBG_05542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 193 aa AA seqDB search
MPTNRRSTGGARARPGPNKGQSTISFSNKVSKPVPRQELKKAAVTKGDRIVTHAKKEEEV
PEAVEIEVEPEVEQPEPKVEVPQKTEVQIRAEKTTDAQINKYWRNIEAERIAKRVHVEDL
STGEKVLRYFDVSSQYGPCVGIQRMRRWERANKLGLNPPIEVLAVLLKEQKEGSQSERAH
MDAILNSTAVGST
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaaaccgcagatcaactggcggcgctcgcgcccgccctggacccaacaaaggt
caatcgaccatcagcttctccaacaaggtttcaaagcctgtacctcggcaggaactgaag
aaagccgctgtcaccaagggcgaccgcattgttacacatgccaaaaaggaggaggaggtt
cctgaggccgtcgagatcgaggtcgaacctgaggtagagcagccggagccaaaggtcgag
gtgccacagaagaccgaggtccagatccgcgccgagaagacgaccgatgcgcagatcaac
aagtactggcggaacattgaggcggagcgcattgccaagagggtgcatgtggaagacttg
agcacgggggagaaggtgctgcggtatttcgacgtcagctcgcagtacgggccctgtgtc
ggaatccaacggatgaggcgctgggagagggccaacaagctcggcctcaaccctcccatc
gaggttcttgccgtgctgctcaaggagcagaaggagggcagccaatctgagcgcgcgcat
atggatgcgattctcaactccacagcagtcgggtcaacatga

DBGET integrated database retrieval system