KEGG   Verticillium alfalfae: VDBG_05636Help
Entry
VDBG_05636        CDS       T02227                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
val  Verticillium alfalfae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VDBG_05636
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VDBG_05636
Transfer RNA biogenesis [BR:val03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VDBG_05636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MDSEYLAELTTTISAVQRAAKLSKIVLAAANNRVGHIDKDDHSPVTVADFACQAILTATL
TAAFPSDSFVGEEAADDLRANPDLLAAVWAILQEVKAAEVEGEDGASVVRFPTSPDHTCE
LIDRAGLGQPHKGRVWVFDPIDGTKTYLRGEIYAVNACLLVGGKQTVAVVGLPNLAPDAT
PPIQNHTIDPNPHGGSLLYAVRGRGSFLRPLPGAADLAGTRIPQHPTDTSSYRLVTSTDA
DSSIPGIHEKIATRMGLAYPGNDLLGWVPRWASLALGHANVTFWVYKKRERLGKIWDHAG
AMLMFQEAGGKVTDVDGREPDLTAGRKMVANFGWVAAPAGVHAEILAAVQDAVRAEGHGD
LLRPLA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggactcagagtacctcgccgagctcacgacaacgatatcggccgttcaacgcgctgcg
aagttatcaaaaattgtcctggccgctgccaacaaccgcgtgggacacatcgacaaggat
gatcacagccctgtcaccgtggccgactttgcttgccaggccatcctcaccgccaccctt
acggctgcctttcctagtgactcctttgtcggcgaagaggctgctgacgacctacgagcg
aaccccgatttgctagcagccgtatgggcgattctgcaagaggtcaaagccgccgaggtc
gagggtgaggatggtgcctcggtcgtccgcttcccaacgtcgccagaccacacctgcgag
ctcatcgaccgtgcaggcctcggccagcctcacaaggggcgggtctgggtgttcgacccc
atcgacggcacaaaaacctaccttcgcggcgagatttatgccgtcaacgcctgccttctc
gtcggcggcaagcaaactgtcgctgtcgtgggcctgccgaacctcgcgcctgacgccacg
cccccgatccagaatcacaccatcgacccgaacccgcacggcggctccctcctctacgcc
gtccgcgggcgcgggtcgttcctccggccgctgcccggggccgccgacctggccggcacc
cgcatcccgcagcaccccaccgacacgtcatcgtaccgcctcgtcacgagcacggacgcc
gactcgtccatccccggcatccacgagaagatcgccacgcgcatgggtctcgcctatccc
ggcaacgatctcctcggctgggtaccgcgctgggcctccctcgccctcggccacgccaat
gtgaccttttgggtctacaagaagagggagcgcctcggcaagatctgggaccacgccggc
gccatgctcatgttccaggaggccggcggcaaggtgactgacgtcgatggcagggagccc
gacctgacggcagggcgtaagatggttgccaattttggttgggttgccgcgccggcgggc
gtgcatgccgagatcctagctgccgtgcaggatgctgtcagggcagaggggcatggggat
cttctgcggccgttggcgtga

DBGET integrated database retrieval system