KEGG   Verticillium albo-atrum: VDBG_05636Help
Entry
VDBG_05636        CDS       T02227                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
val  Verticillium albo-atrum
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:val00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MDSEYLAELTTTISAVQRAAKLSKIVLAAANNRVGHIDKDDHSPVTVADFACQAILTATL
TAAFPSDSFVGEEAADDLRANPDLLAAVWAILQEVKAAEVEGEDGASVVRFPTSPDHTCE
LIDRAGLGQPHKGRVWVFDPIDGTKTYLRGEIYAVNACLLVGGKQTVAVVGLPNLAPDAT
PPIQNHTIDPNPHGGSLLYAVRGRGSFLRPLPGAADLAGTRIPQHPTDTSSYRLVTSTDA
DSSIPGIHEKIATRMGLAYPGNDLLGWVPRWASLALGHANVTFWVYKKRERLGKIWDHAG
AMLMFQEAGGKVTDVDGREPDLTAGRKMVANFGWVAAPAGVHAEILAAVQDAVRAEGHGD
LLRPLA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggactcagagtacctcgccgagctcacgacaacgatatcggccgttcaacgcgctgcg
aagttatcaaaaattgtcctggccgctgccaacaaccgcgtgggacacatcgacaaggat
gatcacagccctgtcaccgtggccgactttgcttgccaggccatcctcaccgccaccctt
acggctgcctttcctagtgactcctttgtcggcgaagaggctgctgacgacctacgagcg
aaccccgatttgctagcagccgtatgggcgattctgcaagaggtcaaagccgccgaggtc
gagggtgaggatggtgcctcggtcgtccgcttcccaacgtcgccagaccacacctgcgag
ctcatcgaccgtgcaggcctcggccagcctcacaaggggcgggtctgggtgttcgacccc
atcgacggcacaaaaacctaccttcgcggcgagatttatgccgtcaacgcctgccttctc
gtcggcggcaagcaaactgtcgctgtcgtgggcctgccgaacctcgcgcctgacgccacg
cccccgatccagaatcacaccatcgacccgaacccgcacggcggctccctcctctacgcc
gtccgcgggcgcgggtcgttcctccggccgctgcccggggccgccgacctggccggcacc
cgcatcccgcagcaccccaccgacacgtcatcgtaccgcctcgtcacgagcacggacgcc
gactcgtccatccccggcatccacgagaagatcgccacgcgcatgggtctcgcctatccc
ggcaacgatctcctcggctgggtaccgcgctgggcctccctcgccctcggccacgccaat
gtgaccttttgggtctacaagaagagggagcgcctcggcaagatctgggaccacgccggc
gccatgctcatgttccaggaggccggcggcaaggtgactgacgtcgatggcagggagccc
gacctgacggcagggcgtaagatggttgccaattttggttgggttgccgcgccggcgggc
gtgcatgccgagatcctagctgccgtgcaggatgctgtcagggcagaggggcatggggat
cttctgcggccgttggcgtga

DBGET integrated database retrieval system