KEGG   Verticillium alfalfae: VDBG_05804Help
Entry
VDBG_05804        CDS       T02227                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
val  Verticillium alfalfae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VDBG_05804
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VDBG_05804
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDBG_05804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 496 aa AA seqDB search
MSKNIEFVGAIDQGTTSSRFLIFNPKGEVVATHQLEFKQLYPQPGWHEHDPEELISSVET
CIDGAVKAFETQGHSKSQIKAVGITNQRETTVVWDKNTGKALYNAIVWTDTRAQELVRRL
KHRLGAGELTKRCGLPLSTYPSVSKLLWLIENVKEVKAAYDAGNLAFGTVDAWLVYKLNG
GPPPNIHTRAYDDELIDWFRVDRNKVQLPTIVRSADSDVYGSLASTSLKGIKIAGVLGDQ
SAALVGQKGFFPGLAKNTYGTGCFLLYNVGDKPVISSHGLMTTIAFDFGDKGGCAYALEG
SIAVAGSSVKFLVDNLGFIEESSKLSALAETVEDNGGCTFVTAFSGLFAPYWIDDARGTI
FGITAYTKRGHIARATLEATCFQTKAILDSMEKDSGAALTELAVDGGMCNSDLIMQTQSD
LIGMPVNRPAMRETTAFGAAIAAGLAVGVWDSFDDLKNTNTEGRTIFKPQINDDESAKRF
KKWEKAVQMSAGWANE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacattgagtttgtcggtgccatcgaccagggcaccaccagctctcgtttc
ctcattttcaaccccaagggtgaggttgtcgcaacgcaccagctcgagttcaagcagctg
taccctcagcctggatggcacgagcatgaccccgaggagctcatctcctccgtcgagacg
tgcattgacggcgccgtaaaggcctttgagactcagggtcactccaagagccagatcaag
gccgtcggcatcaccaaccagcgcgagacgaccgtcgtctgggacaagaacacgggcaag
gccctctacaacgccattgtctggaccgacacccgtgcccaggagctcgtccgccgtctc
aagcaccgcctcggcgccggtgagctcaccaagcgctgcggtctgcctctctccacatac
ccctccgtcagcaagctgctgtggttgatcgagaacgtcaaggaggtcaaggccgcctac
gatgccggcaacctggccttcggcaccgtcgacgcctggctcgtctacaagctcaacggc
ggtccccccccaaacattcacacccgtgcctacgacgacgagctcattgactggttccgt
gtcgaccgcaacaaggtccagctgcccaccattgtccgctctgccgacagcgacgtctac
ggctccctggccagcacctcgctcaagggcatcaagattgccggtgttctgggtgaccag
tcggctgccctcgtcggtcaaaagggcttcttccccggcctcgctaagaacacctacggc
accggctgcttcctcctctacaacgttggcgacaagcccgtcatctcctcccacggtctc
atgaccacaattgccttcgatttcggtgacaagggcggctgcgcttatgctctcgagggc
agcatcgccgttgctggttccagtgtcaagttccttgtcgacaacctcggcttcattgag
gagtcctccaagctcagcgccctggccgagacggtcgaggacaacggtggctgcaccttc
gtcaccgccttcagcggcctcttcgccccctactggattgatgacgctcgtggcaccatt
ttcggcatcacggcctacaccaagcgcggtcacattgcccgcgccactctggaggctacc
tgcttccagaccaaggccatcctcgactccatggagaaggacagtggcgccgctctgacc
gagcttgccgtcgatggtggcatgtgcaactcggacctcatcatgcagacccagtctgac
ttgatcggcatgcctgtcaaccgtcccgctatgcgcgagacaactgcctttggcgctgcg
atcgctgccggcctggccgtcggtgtgtgggactcgttcgacgacctcaagaacaccaac
acggagggccgcaccatcttcaagcctcagatcaatgacgatgagtcggccaagcgcttc
aagaagtgggagaaggccgtgcagatgagcgccggctgggctaatgagtaa

DBGET integrated database retrieval system