KEGG   Verticillium alfalfae: VDBG_05809Help
Entry
VDBG_05809        CDS       T02227                                 

Definition
steroid 5 alpha-reductase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     VDBG_05809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MSLIENWLPPTRENWKTILSVWQISYPILGSLQYLISWYGMGKTSVKSRVNLPGRVAWFL
MEIPGFSILLYVMRTLPGLSGITDLPWQNKVLAGLFVIHYSYRAVIFPFIQPSMSPIHPL
VAILATSFQLVNGTCIGAYLAAYGPTTEAQWSAALAPFGTAQFVAGIAVFYCGLVGNYFH
DEELREIRRVEQRRHERVARDKQQNGDARPTVDKHYRVPNTLLFRYMLYPHYLCEWIEWF
GFWMASGWSVPARAFLINEIAAMLPRAIKGRKWYAEQFGEDKIRKKWAVLPGLY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcattgagaattggcttcctccgacgagagagaattggaagaccattctgagc
gtttggcaaatctcgtacccaatcctcggttctctacagtacctcatctcatggtatggt
atgggcaagacatcggtaaaaagccgtgtcaacctgcccggccgcgttgcgtggttcctc
atggagatcccaggcttctccatcctactttatgtcatgagaacgctgcccggcctctcc
ggcatcacggaccttccgtggcagaacaaagtgcttgccggtctttttgtcattcactac
tcatatcgcgcagtgattttccccttcatccagccgtccatgtctccaatccatccgctc
gtcgccatactcgccacgagcttccagctcgtcaacggcacctgcataggcgcctacctg
gcggcgtacgggccgacgactgaggcgcagtggtccgccgccctcgcgccgtttggcacc
gcgcagttcgtcgctggcatcgccgtcttctactgcggcctcgtcggcaactactttcac
gatgaggagctgcgcgagatccgccgcgtagagcagcggcgacatgaacgcgtcgcccgc
gacaagcagcagaacggagacgcccgaccgactgtcgacaagcactaccgtgtgcccaac
accttgttgttcaggtacatgctgtaccctcactatctttgcgagtggattgagtggttc
ggtttctggatggcctccggctggtccgtgcctgcacgtgctttcctcatcaatgagatt
gccgccatgcttccgagagccatcaagggacgaaagtggtacgccgagcagtttggagaa
gacaagattcggaagaagtgggcagttcttccggggctctactaa

DBGET integrated database retrieval system