KEGG   Verticillium alfalfae: VDBG_05863Help
Entry
VDBG_05863        CDS       T02227                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
val  Verticillium alfalfae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VDBG_05863
   00052 Galactose metabolism
    VDBG_05863
   00500 Starch and sucrose metabolism
    VDBG_05863
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_05863
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VDBG_05863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MASAIKSALPSHLSPLAGAGNGGKDSGNEQEFTSRHHGKTRSHMPFPSSASYRLIREIAC
VYICALSRGQPRGQPQKAHQGPVDSSAFENTSTNVAAAQMRNALTQLAESVEDPEQKKLF
DTEMDNFFALFRRYLNDKAKGNAVDWDRIAPPAQGQVVDYEDLANTEAVQFLDKLAVLKL
NGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYNVNVPFILMNSFNTNDDTAA
IIKKYEGHNVDILTFNQSRYPRILKDSLLPVPKKFESSISEWYLRATVMASSPSTTLASS
TAHERGIEMSLSNVDNWRVVTSNDELEMGDHPQRKDHSLVIRRASRDISIIQLETAVGAA
IRHFNNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTVKHGQLQMSSSRFGDAPLIKLGSDF
KKVSDFQKHIPSIPKIIELDHLTITGGVNLGRGVTLKGTVIIVATEGSTIDIPPGSILEN
VVVQGSLRLLEH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcaattaagagcgcgctgccttcccacctgtcaccccttgctggtgctggc
aatggcggcaaggattccggcaacgagcaggagttcacctcgcgccaccacggcaagacg
aggtcgcacatgccttttccctcttctgcgagttaccgtttgattcgcgagattgcgtgc
gtgtacatttgtgcgttgtctcgtggccagccgcgtggccagccgcaaaaagctcaccag
ggcccagtcgattcttctgctttcgagaacacttcgaccaatgtcgccgctgcccagatg
cgcaatgcgctcacccagcttgctgagtccgtggaggaccctgagcagaagaagctgttt
gacacggagatggacaacttcttcgccctcttccgtcgctacctgaacgacaaggccaag
ggcaacgctgtcgactgggaccgcatcgcccctcccgcccagggccaggttgtcgattac
gaagatctcgccaatacggaggccgtccagttcctcgacaagctggccgtcctcaagctc
aacggtggtctcggtacctcgatgggctgtgtcggtcccaagtcggtcattgaggttcgc
gacggcatgtccttcctcgacctttccgtccgtcagatcgagtacctgaaccgcacgtac
aacgtcaatgtgccctttattctgatgaactcgttcaacaccaacgatgataccgccgct
attatcaagaagtacgaaggtcacaacgttgacatcctcaccttcaaccagtcccgttac
ccccgtatcttgaaggactccctcctgcccgtccccaagaagttcgagtcttccatctcc
gaatggtacctccgggccacggtgatggcttcgagtccctctacaactctggcatcctcg
acagctcatgagcgcggtatcgagatgtctctctctaatgtcgacaactggcgcgtcgtg
acctccaacgacgagcttgagatgggagatcatccccaacggaaagaccattccctggtg
ataagaagggcgagtcgggacatctccatcatccagctcgagacagctgtgggcgctgct
attcgccacttcaacaacgcgcacggcgtcaatgtgccccgcaggcgcttcctgcccgtc
aagacgtgctctgacctgatgctcgtcaagtctgatctttacaccgtcaagcacggccag
ctccaaatgagctcgtcccgttttggcgacgctcccctcatcaagctgggcagcgacttc
aagaaggtctctgacttccagaagcatattccttcaatccctaagatcatcgagctcgac
catctgaccatcactggtggcgtaaatctcggtcgtggagtgactctgaagggcaccgtc
attattgtggcgaccgagggcagcaccattgacatccctcccggatctatcctcgagaac
gtggttgtccagggaagcttgcgtctgctggagcactag

DBGET integrated database retrieval system