KEGG   Verticillium albo-atrum: VDBG_05863Help
Entry
VDBG_05863        CDS       T02227                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
val  Verticillium albo-atrum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:val00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:val00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:val00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:val00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MASAIKSALPSHLSPLAGAGNGGKDSGNEQEFTSRHHGKTRSHMPFPSSASYRLIREIAC
VYICALSRGQPRGQPQKAHQGPVDSSAFENTSTNVAAAQMRNALTQLAESVEDPEQKKLF
DTEMDNFFALFRRYLNDKAKGNAVDWDRIAPPAQGQVVDYEDLANTEAVQFLDKLAVLKL
NGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYNVNVPFILMNSFNTNDDTAA
IIKKYEGHNVDILTFNQSRYPRILKDSLLPVPKKFESSISEWYLRATVMASSPSTTLASS
TAHERGIEMSLSNVDNWRVVTSNDELEMGDHPQRKDHSLVIRRASRDISIIQLETAVGAA
IRHFNNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTVKHGQLQMSSSRFGDAPLIKLGSDF
KKVSDFQKHIPSIPKIIELDHLTITGGVNLGRGVTLKGTVIIVATEGSTIDIPPGSILEN
VVVQGSLRLLEH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcaattaagagcgcgctgccttcccacctgtcaccccttgctggtgctggc
aatggcggcaaggattccggcaacgagcaggagttcacctcgcgccaccacggcaagacg
aggtcgcacatgccttttccctcttctgcgagttaccgtttgattcgcgagattgcgtgc
gtgtacatttgtgcgttgtctcgtggccagccgcgtggccagccgcaaaaagctcaccag
ggcccagtcgattcttctgctttcgagaacacttcgaccaatgtcgccgctgcccagatg
cgcaatgcgctcacccagcttgctgagtccgtggaggaccctgagcagaagaagctgttt
gacacggagatggacaacttcttcgccctcttccgtcgctacctgaacgacaaggccaag
ggcaacgctgtcgactgggaccgcatcgcccctcccgcccagggccaggttgtcgattac
gaagatctcgccaatacggaggccgtccagttcctcgacaagctggccgtcctcaagctc
aacggtggtctcggtacctcgatgggctgtgtcggtcccaagtcggtcattgaggttcgc
gacggcatgtccttcctcgacctttccgtccgtcagatcgagtacctgaaccgcacgtac
aacgtcaatgtgccctttattctgatgaactcgttcaacaccaacgatgataccgccgct
attatcaagaagtacgaaggtcacaacgttgacatcctcaccttcaaccagtcccgttac
ccccgtatcttgaaggactccctcctgcccgtccccaagaagttcgagtcttccatctcc
gaatggtacctccgggccacggtgatggcttcgagtccctctacaactctggcatcctcg
acagctcatgagcgcggtatcgagatgtctctctctaatgtcgacaactggcgcgtcgtg
acctccaacgacgagcttgagatgggagatcatccccaacggaaagaccattccctggtg
ataagaagggcgagtcgggacatctccatcatccagctcgagacagctgtgggcgctgct
attcgccacttcaacaacgcgcacggcgtcaatgtgccccgcaggcgcttcctgcccgtc
aagacgtgctctgacctgatgctcgtcaagtctgatctttacaccgtcaagcacggccag
ctccaaatgagctcgtcccgttttggcgacgctcccctcatcaagctgggcagcgacttc
aagaaggtctctgacttccagaagcatattccttcaatccctaagatcatcgagctcgac
catctgaccatcactggtggcgtaaatctcggtcgtggagtgactctgaagggcaccgtc
attattgtggcgaccgagggcagcaccattgacatccctcccggatctatcctcgagaac
gtggttgtccagggaagcttgcgtctgctggagcactag

DBGET integrated database retrieval system