KEGG   Verticillium alfalfae: VDBG_05885Help
Entry
VDBG_05885        CDS       T02227                                 

Definition
disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
val  Verticillium alfalfae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    VDBG_05885
Enzymes [BR:val01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VDBG_05885
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VDBG_05885
  Exosomal proteins of colorectal cancer cells
   VDBG_05885
  Exosomal proteins of bladder cancer cells
   VDBG_05885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
MHCKRVAFGLLAAAAAVAAADDSDVTQLKKDTFDDFVKTNDLVLAEFFAPWCGHCKALAP
EYEEAATSLKEKNIKLAKIDCTEEADLCQTYGTLVVVVVFLLLLLHLLLPKPGQRRRGTQ
LPAPRTASNPRLGGRLPALLELALDGLVGAECDAVGAKLFQDAPLLLLPSLPAVSLLTKD
TLEEFKTADKVVLVAYIAADDKASNETFNKVAESLRDNYLFGGVNDAAVAEAEGVKAPAI
VLYKSFDEGKTTFSDKFEVEAIEKFAKTSATPLIGEVGPETYSGYMEAGLPLAYIFAETA
EEREELSKALKPIAEKQRGVINFATIDAKSFGAHAGNLNLQADKFPAFAIQETVKNQKFP
FDQEKKITVEEITSFVDDFVAGKIEPSIKSEPIPETQEGPVTVVVAKNYEQIVLDDTKDV
LIEFYAPWCGHCKALAPKYEELATLYSESEFKDKVVIAKVDATLNDVPDEIQGFPTIKLY
PAGGKSEPVTYSGSRTIEDLIEFVRDNGKYKAEASKKEEVVAEESQAAPAATEGEAAKES
DESHDEL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaagcgtgttgcctttggcctcctggccgccgccgcggctgtcgccgccgct
gacgattcggacgtcacccagctcaagaaggacaccttcgatgactttgtcaagaccaac
gacctcgtccttgctgagttctttgctccctggtgcggccactgcaaggccctcgctccc
gagtacgaggaggctgccacgtccctgaaggagaagaacatcaagctcgccaagattgac
tgcactgaggaggccgacctctgccagacctacggcacgctcgtcgtcgtcgtcgtcttc
ctcctcctgctgctccaccttttgctgcccaaaccgggccagcgccgccgcggcacgcag
ctccctgcccctcgcactgccagcaaccctcggcttggcggccgtcttcctgcccttctc
gagctcgctcttgacggcctcgtcggcgccgagtgcgacgccgttggcgccaaacttttt
caggatgcgcctctccttctgctcccgtctctgcctgctgtctctctgctcaccaaggac
acccttgaggagttcaagactgccgacaaggtcgtcctcgtcgcctacattgccgccgat
gacaaggcctccaacgagaccttcaacaaggtcgccgagagcctccgcgacaactacctc
ttcggcggtgtcaacgatgccgccgttgccgaggctgagggcgtcaaggcccctgccatt
gtcctctacaagtctttcgacgagggcaagaccaccttctccgacaagttcgaggtcgag
gccatcgagaagttcgccaagacctccgccactcccctgattggcgaggtcggccctgag
acctactccggttacatggaggccggccttcccctggcctatatcttcgccgagacggcc
gaggagcgtgaggagctctccaaggctctcaagcccatcgccgagaagcagcgtggtgtc
atcaacttcgccaccattgacgccaagtctttcggtgcccacgccggcaacctgaacctc
caggctgacaagttccctgccttcgccatccaggagacggtcaagaaccagaagttcccc
ttcgaccaggagaagaagatcaccgtcgaggagatcacctctttcgtcgatgacttcgtc
gctggcaagatcgagcccagcatcaagtctgagcccatccccgagacccaggagggtccc
gtcaccgttgttgtggccaagaactacgagcagattgtgcttgacgacaccaaggatgtt
ctcattgagttctacgccccctggtgcggtcactgcaaggctctggcccccaagtacgag
gagctcgccaccctctacagcgagagcgagttcaaggacaaggttgtcattgccaaggtt
gatgccaccctgaacgacgttcccgatgagatccagggcttccccaccatcaagctgtac
cccgccggcggcaagtctgagcctgtcacctactcgggctcccgcactattgaggacctc
attgagtttgtccgtgacaacggcaagtacaaggccgaggcctccaagaaggaggaggtt
gttgccgaggagagccaggccgcgcccgccgccaccgagggtgaggccgccaaggagtct
gacgagtctcacgatgagctgtaa

DBGET integrated database retrieval system