KEGG   Verticillium albo-atrum: VDBG_05885Help
Entry
VDBG_05885        CDS       T02227                                 

Definition
disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
val  Verticillium albo-atrum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:val04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
MHCKRVAFGLLAAAAAVAAADDSDVTQLKKDTFDDFVKTNDLVLAEFFAPWCGHCKALAP
EYEEAATSLKEKNIKLAKIDCTEEADLCQTYGTLVVVVVFLLLLLHLLLPKPGQRRRGTQ
LPAPRTASNPRLGGRLPALLELALDGLVGAECDAVGAKLFQDAPLLLLPSLPAVSLLTKD
TLEEFKTADKVVLVAYIAADDKASNETFNKVAESLRDNYLFGGVNDAAVAEAEGVKAPAI
VLYKSFDEGKTTFSDKFEVEAIEKFAKTSATPLIGEVGPETYSGYMEAGLPLAYIFAETA
EEREELSKALKPIAEKQRGVINFATIDAKSFGAHAGNLNLQADKFPAFAIQETVKNQKFP
FDQEKKITVEEITSFVDDFVAGKIEPSIKSEPIPETQEGPVTVVVAKNYEQIVLDDTKDV
LIEFYAPWCGHCKALAPKYEELATLYSESEFKDKVVIAKVDATLNDVPDEIQGFPTIKLY
PAGGKSEPVTYSGSRTIEDLIEFVRDNGKYKAEASKKEEVVAEESQAAPAATEGEAAKES
DESHDEL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcaagcgtgttgcctttggcctcctggccgccgccgcggctgtcgccgccgct
gacgattcggacgtcacccagctcaagaaggacaccttcgatgactttgtcaagaccaac
gacctcgtccttgctgagttctttgctccctggtgcggccactgcaaggccctcgctccc
gagtacgaggaggctgccacgtccctgaaggagaagaacatcaagctcgccaagattgac
tgcactgaggaggccgacctctgccagacctacggcacgctcgtcgtcgtcgtcgtcttc
ctcctcctgctgctccaccttttgctgcccaaaccgggccagcgccgccgcggcacgcag
ctccctgcccctcgcactgccagcaaccctcggcttggcggccgtcttcctgcccttctc
gagctcgctcttgacggcctcgtcggcgccgagtgcgacgccgttggcgccaaacttttt
caggatgcgcctctccttctgctcccgtctctgcctgctgtctctctgctcaccaaggac
acccttgaggagttcaagactgccgacaaggtcgtcctcgtcgcctacattgccgccgat
gacaaggcctccaacgagaccttcaacaaggtcgccgagagcctccgcgacaactacctc
ttcggcggtgtcaacgatgccgccgttgccgaggctgagggcgtcaaggcccctgccatt
gtcctctacaagtctttcgacgagggcaagaccaccttctccgacaagttcgaggtcgag
gccatcgagaagttcgccaagacctccgccactcccctgattggcgaggtcggccctgag
acctactccggttacatggaggccggccttcccctggcctatatcttcgccgagacggcc
gaggagcgtgaggagctctccaaggctctcaagcccatcgccgagaagcagcgtggtgtc
atcaacttcgccaccattgacgccaagtctttcggtgcccacgccggcaacctgaacctc
caggctgacaagttccctgccttcgccatccaggagacggtcaagaaccagaagttcccc
ttcgaccaggagaagaagatcaccgtcgaggagatcacctctttcgtcgatgacttcgtc
gctggcaagatcgagcccagcatcaagtctgagcccatccccgagacccaggagggtccc
gtcaccgttgttgtggccaagaactacgagcagattgtgcttgacgacaccaaggatgtt
ctcattgagttctacgccccctggtgcggtcactgcaaggctctggcccccaagtacgag
gagctcgccaccctctacagcgagagcgagttcaaggacaaggttgtcattgccaaggtt
gatgccaccctgaacgacgttcccgatgagatccagggcttccccaccatcaagctgtac
cccgccggcggcaagtctgagcctgtcacctactcgggctcccgcactattgaggacctc
attgagtttgtccgtgacaacggcaagtacaaggccgaggcctccaagaaggaggaggtt
gttgccgaggagagccaggccgcgcccgccgccaccgagggtgaggccgccaaggagtct
gacgagtctcacgatgagctgtaa

DBGET integrated database retrieval system