KEGG   Verticillium alfalfae: VDBG_05956Help
Entry
VDBG_05956        CDS       T02227                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VDBG_05956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 272 aa AA seqDB search
MAANTTRQFARTALRSSTRTAFAAAPRQAFRQGHRFYSSEAPKAAGPNWALLSGLAVAGA
GGAYFFTREGGVSAGSVPKVVNPTKKDYQDVYNEIASRLEEKDDYDDGSYGPVLVRLAWH
ASGTYDKETGTGGSNGATMRFAPEGDHGANAGPEGGARLPRAPASPGPWTFSPTVLTNDY
FRLLLEEKWQWKKWDGPKQLEDKSTKTLMMLPTDYALIEDKAFLKTVKAYAKDNELFFKD
FSNVIVRLFELGVPFKEGTESWVMKPTWDESP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacacgacccgtcagttcgcccgcacggcgctgcgctcctccacacgtacc
gccttcgccgctgcgccccgccaggccttccgccagggccaccgtttctactcttccgag
gcccccaaggctgccggccccaactgggctctgctgtctggcctcgccgtcgccggtgcc
ggtggcgcctacttcttcacccgcgagggcggcgtctcggccggctcggtgcccaaggtc
gtcaaccccaccaagaaggactaccaggacgtctacaacgagatcgcctcgcgcctcgag
gagaaggacgactacgacgacggcagctacggccccgtcctcgtgcgcctcgcgtggcac
gccagcggcacctacgacaaggagacgggcacgggcggcagcaacggcgcgacgatgcgc
ttcgcccccgagggcgaccacggcgccaacgccgggcctgaaggcggcgcgcgacttcct
cgcgccccagcttcaccgggcccctggaccttctcgcccacggtgctgaccaatgactac
ttccgcctgctgctcgaggagaagtggcagtggaagaagtgggacggccccaagcagctc
gaggacaagtcgaccaagacgctcatgatgctgccgaccgactacgccctcatcgaggac
aaggcgttcctcaagacggtcaaggcctacgccaaggacaacgagctcttcttcaaggac
ttctccaacgtcattgtccgcctctttgagctcggcgtgcccttcaaggagggcaccgag
agctgggtcatgaagcccacctgggacgagtcgccttga

DBGET integrated database retrieval system