KEGG   Verticillium albo-atrum: VDBG_05989Help
Entry
VDBG_05989        CDS       T02227                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
val  Verticillium albo-atrum
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:val00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 759 aa AA seqDB search
MASTTATPQGSKTEYGVGLAITTLLAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYF
FDVHPPFGKLLFAFMGWLVGYDGHFHFDNIGDSYITNKIPYVAFRALPAILGALTVYCDL
PHHVGVWLQSSCLSARRPALFLLDNAHIGQTRLILLDATLVLSPWHAACSAYIKFHKACA
TEPFSRRWWKWLILTGFALSADISVKYVGLFAFVTIGSAVAIDLWELLDVKRPGGALSLP
DFTKHFLARAFGLIIMPFLFYLFWFQVHFAILNRSGPGDDFMSPEFQETLSDNVMLANSL
EINYYDSLTIRHKETKTYLHSHPDRYPLRYDDGRVSSQGQQITGYPFNDTNNYWQILPLE
GEETTGRVVRNHDLEALGARAKDTVFEIRIEHGKKKQSLKSVAMWTHSKALPDWGHKQQE
INGNKQLTAASNVWFVEDIPSLPEDDARRAKPEKKVKTMPFLKKWFELQRAMFWHNNQLT
SSHPYSSHPYQWPFLLRGVSFWTKNDTRQQIYFLGNPVGWWIASSLLAVFVGIIGADQVS
LRRGIDALDRRSRNRLYNSTGFFFLAWATHYFPFYLMGRQLFLHHYLPAHLASCLVAGAL
LEFIFLAEPVGEHKKTKKVEDAPKRHLTARERLGGQSMAGAWIAATVVLALAVAGWWFFP
APDVRLPRPVGRPGGAAQVARLRPALCQIKGDCIATRGRRYSVGYSVGYSVWGAPEASPL
LMKLLSWIAPEATQYARGAQQLCASRGASEMGWLGVTKP
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacgactgccaccccgcagggaagcaagaccgagtatggcgttggacttgcc
atcaccacccttttggcattcgtcaccagattctggggcatcagccacccgaacgaggta
gtattcgacgaggttcacttcggcaagtttgcctcttactacctcgagcgtacctacttc
ttcgacgtgcaccctcccttcggaaagctcctgtttgcctttatgggatggcttgtggga
tacgatggtcacttccacttcgacaacatcggtgactcgtacatcaccaacaagattccc
tacgttgccttccgagcccttcccgctatcctcggcgctcttactgtttactgtgaccta
cctcatcatgtgggagtctggctacagtcttcctgcctgtctgctcgccgcccggccttg
ttccttcttgacaacgctcacatcggtcagacccgtctcattctgctcgacgccactctc
gttctttcgccatggcatgcagcttgctctgcttatatcaaattccacaaggcttgcgcc
actgagccgttctcccgcaggtggtggaagtggcttatcctcacgggcttcgcgctctcg
gctgacatctctgtcaagtacgtgggtctcttcgcctttgtcaccatcggctcggcggtc
gccattgacctgtgggagcttctcgacgtcaagaggcccggcggtgcgctgagcctgccc
gacttcactaagcacttcctcgcccgtgcctttggcctcatcatcatgcccttcctcttc
tacctcttctggttccaggttcactttgccatcctcaaccgatccggccccggtgacgac
ttcatgtcgccagagttccaggaaaccctcagcgacaacgtcatgcttgccaactcgctg
gaaatcaactactacgactcgctcaccatccgccacaaggagacaaagacgtacctgcac
agccaccctgaccgctatcctctcaggtacgacgacggtcgtgtgtcgagccagggccag
cagattacaggctatccctttaatgacacgaacaactactggcagatcctccccttggag
ggagaggagaccactggccgtgtcgtcaggaaccacgacctcgaggccctcggtgcccgc
gccaaggacacggtctttgagatccgcatcgagcacggcaagaagaagcagtcgctcaag
agcgtagccatgtggacacactcgaaggcgctgccagactggggccacaaacagcaggag
atcaacggcaacaagcagctcacggcggcgtccaacgtctggttcgtcgaggacatcccg
tcgctccccgaggacgatgcgcgccgtgccaagcccgagaagaaggtcaagacgatgcca
ttcctcaagaagtggttcgagctgcagcgcgccatgttctggcacaacaaccagctgacc
agcagccacccgtactcgagccacccataccagtggcccttcctactccgcggcgtgagc
ttctggaccaagaacgacacgcgccagcagatctacttcctgggcaacccagtgggctgg
tggattgccagcagtcttctcgctgtgtttgtcggcatcattggtgccgatcaggtgtct
ctgcgccgtggcatcgacgctctggatcgccgctcccgcaaccgtctctacaactcgacg
ggcttcttcttcctcgcgtgggcgacgcactacttccccttttacctcatgggccgccag
ctgttcctgcaccactacctgccggcacacctggcgtcgtgtctcgtggccggtgccctc
ctcgagttcatcttcctggcggagcccgtcggtgagcacaagaagacgaagaaggtcgag
gacgcgccgaagcgacacctcacggcgcgtgagcgtctcggcggacagagcatggcgggc
gcgtggatcgcggccaccgtggtactcgccctcgccgtcgcgggctggtggtttttccct
gcccctgacgtacggctaccccggcctgtcggtcgaccaggtggtgcggcgcaagtggct
cggctacgacctgcactttgccaaataaagggcgattgtatcgccactcgaggccgacgc
tatagcgtcgggtatagcgtcgggtatagcgtctggggtgctcctgaagcaagccctctg
ttgatgaagctgctttcatggatcgcgccagaagccacacagtacgcacgcggtgcgcaa
caactgtgtgcatcgcgaggtgcctcggagatgggctggctgggtgttacgaagccatag

DBGET integrated database retrieval system