KEGG   Verticillium alfalfae: VDBG_06077Help
Entry
VDBG_06077        CDS       T02227                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
val  Verticillium alfalfae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDBG_06077
  Lipid metabolism
   00561 Glycerolipid metabolism
    VDBG_06077
   00600 Sphingolipid metabolism
    VDBG_06077
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    VDBG_06077
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VDBG_06077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 472 aa AA seqDB search
MPLILPVPFNNWNALGCDVSEALLLDTSKKLVNLGLRDLGYNYVVLDDCWSGGRGEDGFQ
YEDRTKFPSGMKAVSDAIHDMGMLFGMYGTAGEMTCARYPGSLDWEENDAKSFAAWGVDY
LKYDNCYSMGRHGSPKVSFDRFDTMRKALNATGRPMIYSLCNWGEDYVYSWGVSIANSWR
MSGDIYDSFSRPDVLCSCEDPSNPLCTSWGTHCSVLNILNKVAAYADRAQPGGWNDLDML
EVGQGGMTDDEYKAHFTMWALVKSPLLIGTDLRKLSASALTILNNPAIIAVSQDPAARSA
LRVAIDYDVKKDKYGVGETQVWSGWLANGDQVVAFLNAADEDRKMKIDLEEVFVRDGPGG
SAEQVQHEWQIYDLWANRMSDDVAEGLLDASEKKDGDKAAKLFDKTKWYNSTELPYKEGL
LKDDERLFGKHVGSVKARGVIEAKVPRHGVVAYRLRTKAPGLKRYSMTKEEL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcattctccccgtgccattcaacaactggaacgcgctcgggtgtgacgtctcg
gaggctctgctcctagacacatccaaaaagcttgtcaaccttggccttcgcgacctgggc
tacaactatgtcgtccttgacgactgctggtccggcggccgtggtgaggatggcttccag
tacgaggaccgaaccaagtttccgagtggcatgaaggcggtctcggacgccatccatgac
atgggcatgctcttcggcatgtacggcaccgctggtgagatgacctgtgcccgctacccg
ggctctctcgactgggaagagaatgatgccaagtccttcgcagcctggggcgtcgattat
ctgaaatacgacaattgctattccatgggtcgccacgggtcccccaaggtctccttcgac
cgtttcgatacgatgcgcaaagctctgaatgccaccggcaggccgatgatctactctctg
tgcaactggggtgaggactacgtctactcttggggcgtttccattgccaactcgtggcgt
atgtcaggcgacatctacgactcgttttctcggcccgacgtgctttgtagctgcgaggac
ccaagcaatccgttgtgcacatcgtggggcacgcactgttccgtgttgaacattctcaac
aaggtcgccgcgtatgctgaccgcgcgcaacctggcggctggaacgacctcgatatgctc
gaggtcgggcagggtggcatgacggatgacgagtacaaggcgcacttcaccatgtgggcg
ctcgtaaagagccctctgctcattggcaccgacctgaggaagctctctgcctcagcgctg
acgattctgaacaacccggccatcatcgcagtgagccaggacccagcggcgaggtcagct
ctgcgcgtggccattgactacgacgtcaagaaggacaagtacggcgtcggcgagacgcag
gtctggagtgggtggttggcaaacggcgaccaggtcgttgcgttcttgaacgcggcggac
gaggaccgtaaaatgaagatcgatcttgaggaggtcttcgttagggatggtccggggggc
tcggcagaacaggttcagcatgagtggcagatctacgatctctgggctaaccgcatgtcc
gatgacgttgcggagggtcttctcgacgccagtgagaagaaggatggagacaaggcggcg
aagctgttcgacaaaaccaagtggtataattcgactgagctgccgtacaaggagggtctg
ctcaaggacgatgagcggctcttcggcaagcatgttggttcagtcaaggcaaggggcgtc
attgaggccaaggtgccgaggcatggtgttgttgcctatagattgaggaccaaggctcca
gggttgaagaggtactccatgaccaaggaggagctgtag

DBGET integrated database retrieval system