KEGG   Verticillium alfalfae: VDBG_06126Help
Entry
VDBG_06126        CDS       T02227                                 

Definition
serine/threonine-protein kinase MPS1
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
val  Verticillium alfalfae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    VDBG_06126
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     VDBG_06126
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: Other group
  TTK family
   VDBG_06126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MATASPTPMGMSQGSGLVRRTSQRQALRRPASRPVLGRTESNPVASAGTTASKKEAQNYT
LNDSSDDEIPVPMKLSALTKALLGGPPEQQAASPPRTRRRVSNLAASFSSATEERRHLRS
GSVHAYESKSSLPTSPHRSKEGKENSPVRKRVIRLSNTPKSLGQLSQPKRRSTSLSRSTQ
RSRTSSRPESRDQSSDEKQAEPQQDVNTPAQGIRVVRIAAGSSGTRGRQGLRIAGMRSQA
DLLESAARPTPRERNGHELEGLPARLPAPRPEIPSGQENEAPPTFKRSKPAVHVALEKEL
DIPKRPASADVGSGRPAASPERKPLAALGGNTPHRPAPPPPPPKMTVLQAATTSAGAATT
SHGKQRRNILRVNGKSYTRLDCVGRGGSAKVYRVTAENGAIFALKRVSLEQADEMAIRGF
KGEIDLLNKLKPVDRVISLFDYEMNDEKRSLTLLMEYGELDLNSLLRSRQNPETARFDPV
FVRYYWKEMLECLLAVHQYDVVHSDLKPANFVLVKGCLKLIDFGIANAIQTDETVNVHRE
TQIGTPNYMSPESLMDFNASHGGRAAGRPKLMKLGKPSDVWSLGCILYQLVYGIPPFGHI
ANHLSRCQAIIDWDHAIEFPSRAVGGVLVPPSLLRTMKRCLNREVHLRPTCEELLHETDP
FLYPVELHDKALPIDEELLGRIIQSVVTRCRERMPTEAEARSVWPGAYWQSVKKATDNSS
KS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcctctcctacaccgatgggcatgtcccagggctctgggctcgttcggaga
acatcacaacgtcaagctcttcgacgccctgcatcacgacctgtccttggtcgtaccgaa
tccaaccccgtggcctcagctgggacaaccgcgtcgaaaaaagaggcccaaaactacacg
ctcaacgacagctccgacgacgagattccagtgcccatgaaactgagtgctctcaccaaa
gcacttctcggcggccctcctgaacagcaagcagcctccccaccacgaacgcgacgccgc
gtcagcaacctcgcggcatccttctcttctgccacagaggagcgccgacatttacgatcg
gggagtgttcacgcgtatgaatcaaagtcgtcactgccaacttcaccacacagaagcaaa
gaaggcaaagaaaacagtcccgttcgtaaacgggtcatcagactcagcaacactccgaaa
agcctcggtcaattgtcccaacccaagcgacggtcgacctccctctcccgctctacacag
cgcagccgaacgtccagccggcccgaaagccgcgatcaatcatccgacgagaagcaagcg
gagccccagcaggacgtgaacactccggctcagggcattcgcgttgtccgaattgctgct
ggatcttccggcaccaggggtagacaagggcttcgcatcgcaggcatgcggtctcaggcg
gaccttttggaatctgctgctaggccaacgccccgcgagagaaacggccacgagcttgaa
ggactccctgcgaggctcccggcgccccgccccgagattccttcgggccaggagaacgag
gcgcctccaactttcaagcggtccaagcctgctgtccacgtcgccctggagaaggagcta
gacattcctaagcgacctgcgagcgccgacgttggtagcggccgtcctgctgcctctcca
gagaggaagcccctggctgcgctgggcggaaatacacctcatcgtccagcacctccgcct
cctccacccaagatgaccgtcctccaggctgccacaacgtccgctggtgcggcaactaca
tcacatggcaagcagaggcgcaatatcctccgtgtcaatggcaagtcgtacacgcggctc
gactgtgtgggacgaggtggcagcgccaaggtgtaccgcgtcactgcggagaacggtgct
attttcgctctgaagcgtgtttctttggagcaggcggacgagatggccatccgaggcttc
aagggcgagatcgatcttctcaacaagctcaagcctgttgatcgagtcatcagcctcttc
gactacgagatgaacgacgagaaaaggtcgttgactttgctcatggaatacggcgagcta
gatctcaattctcttctgagaagtcgacagaatcccgagaccgccaggttcgatccagtc
tttgtccgatattactggaaagagatgctcgagtgtctcctagcggttcaccaatacgat
gtcgtacattcagatctgaagccggcgaacttcgtcctcgtcaagggctgcctgaaactt
atcgactttggtatcgccaacgccatccaaactgatgaaacggtcaacgtccaccgcgaa
acccagatcggaacgccaaactacatgtcgccagagtctttgatggacttcaacgcttct
catggcggacgtgctgctggccgacccaaattgatgaagctcggaaagcccagcgatgtt
tggtctctgggttgcattctttaccagctagtttacggcatacctccattcggtcatatc
gcgaaccacctatcgcgctgccaggccatcattgattgggaccacgccatcgagtttccc
agccgtgctgtgggtggtgttcttgttcccccatcactcctccgtacaatgaagcggtgc
ctcaaccgtgaagttcatctgcgcccaacatgcgaagaacttctgcatgagacggatcct
tttttgtatccggtcgagcttcacgacaaggcactcccgatcgacgaggaactgcttggt
agaatcattcagagcgttgtcacaaggtgccgcgagcgcatgcccaccgaggcagaagcc
aggtccgtctggccaggggcctattggcaaagtgtcaagaaggcgaccgacaatagcagc
aagtcatga

DBGET integrated database retrieval system