KEGG   Verticillium albo-atrum: VDBG_06234Help
Entry
VDBG_06234        CDS       T02227                                 

Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
val  Verticillium albo-atrum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:val00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 481 aa AA seqDB search
MRGSTLLAGAFAQAALAAIEPKNFIFIVPDGMAPASQTIARTYKAMVEGSSRPGAPGIID
ELPVDITPIGNTRTHSNNNLVTDSAAAGTALATGHKTNNGAIGILPDNQPVGSILEAAKL
NGYRTALVVTSIINHATPAAFSSHVVNRNGLAAIAEQQIGYSHPLNQSVDILLGGGRCYF
KPKSDPDSCRDDEIDLFAFAQDKGYYVAQNRSAFDDLEKGLGDIRLPYVGLFNDGDLNYE
IDRQQQPQADREPSLAEMTTAALNSLHRASHCKDKGYFIMIEASRIDHASHAHDSVAHLW
DVLEYNNVVDVVTKWIDEHPDTAMLSVADHETGGLTFPSGYDPRPLAASKHSIAYLTELW
NDYKGDDRRSFLRNEILPSYGVNDATDAEVEALLAGNFAANLAKPMNKRTGHAWSTGGHS
AVDTTLYAYGAEDMGDQLIIDMAGAHDNTELPKYIAKALKVSLEEVTELLRANGTDWIPR
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggctctaccctgcttgctggggctttcgctcaggccgcactagccgccattgag
cccaagaattttattttcattgtccctgatggcatggcaccagcttcgcagacaattgct
cgcacatataaggccatggttgaaggcagctcccgtcctggtgcgcctggaattattgac
gaactaccggtagatatcacgcccatcggtaacacgcgcacccattcgaacaacaatctt
gtcacagactcggccgctgccgggacagctctcgctacgggacacaagacaaacaacggt
gcgattggtattttgcccgacaaccagcctgttggatccattctcgaggctgccaagctg
aatggctaccggactgcccttgttgttaccagcatcatcaaccatgcaactccagccgcc
ttctcatcccatgtggtcaatcgcaatggtctcgctgccattgctgaacaacagatcggc
tacagccacccgttgaatcagtccgtcgacatcctgcttggtggtggacgttgctacttc
aagcccaagtcagacccggattcctgtcgtgacgacgagattgacctcttcgccttcgct
caggataagggctactacgtggcgcagaatcgctcagcgtttgacgaccttgaaaaaggc
ctcggcgacatccgcctcccatatgtcggtcttttcaacgacggtgacctcaactatgaa
atcgatcgccagcagcagcctcaagcggatcgtgaaccctcccttgccgagatgacgacg
gcggccctcaattcgctgcaccgcgcctcgcactgcaaggataagggttacttcatcatg
atcgaggcctcgcgcatcgaccacgcgtcacacgctcacgactcggtcgcgcatctctgg
gacgtcctggagtacaacaacgtcgtcgatgttgtgaccaagtggatcgatgagcacccc
gacacggccatgctatcagtcgccgaccacgaaacaggtggactaaccttcccgagcggc
tatgatccccgtccgctggccgcttccaagcactccatcgcctacctgacggagctgtgg
aacgactacaagggcgacgatcgtcgcagcttcctgagaaacgagatcctcccgtcgtat
ggtgtcaatgacgccacggatgctgaggttgaagcgttgctcgcgggcaactttgcggcg
aaccttgcgaagccgatgaacaagcgcactggtcatgcctggtcgacgggtggtcactcc
gctgtcgacacaacgctgtatgcctatggcgcggaagatatgggtgatcagctcatcatc
gacatggccggcgcgcacgacaacacggagttgccgaagtatatcgcgaaggcgttgaag
gtcagcctagaggaggtgacagagttgctgcgagccaatggcacggactggatccctcgg
gtctga

DBGET integrated database retrieval system