KEGG   Verticillium alfalfae: VDBG_06482Help
Entry
VDBG_06482        CDS       T02227                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
val  Verticillium alfalfae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VDBG_06482
Enzymes [BR:val01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     VDBG_06482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MDVGSCLQTTPPARDPVNSPTQWPAPKSRAPKRRQRRKHNDHGHGHGDAADAPHSASDAE
TASSHSSKASKSKKRKHHHHKSAVSSPEASDADTASQSSKRSKKSRRRHAEADARAANGG
AKRRPSLSQPARDPRDITVRKMKKLQEEQEEDKPAVRTPSPMHIAYIPKNQVIGISKLPR
IAEMFSRRLQIQERLTKEVANAIMEVLKPQGVAVVMESSHLCMVMRGVQKTTASTITSCV
LGCFETKSKTRNEFLSLVGLKKT
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgggatcctgtctccaaaccacgccgcccgctcgtgaccctgtcaattcaccc
acgcaatggccggctccgaagtcacgagctccgaaaaggcgccagcgtcgcaagcacaac
gaccacggccacggccacggcgatgcggcggacgcccctcacagtgccagcgacgccgag
accgcgagcagccactcgagcaaggcgagcaagtcgaagaagcgcaagcaccaccatcac
aagtcggccgtctcctcccccgaggcgagcgacgccgacaccgccagccagagcagcaag
cgctcaaaaaagtcgaggcgcagacatgccgaggccgacgcccgcgccgccaacggcgga
gccaagcgccggccgagcctgagccagccggcccgtgacccgcgggacatcaccgtcagg
aaaatgaagaagctccaggaggagcaggaggaggacaagcccgctgtccgcacccccagt
cccatgcacattgcctacatcccgaagaaccaagtcattggcatctccaagctgccccgc
atcgccgagatgttcagccgccgcctgcagatccaggagcgcctgaccaaggaggtcgcc
aacgccatcatggaggtcctcaagccccagggcgtcgccgtcgtcatggagtcgagccac
ctgtgcatggtcatgcgcggcgtgcaaaagacgacggccagcaccatcacgagctgcgtc
ctcggctgcttcgagacaaagtccaagacgcgcaacgagttcctcagcctcgtggggctc
aagaagacctga

DBGET integrated database retrieval system