KEGG   Verticillium alfalfae: VDBG_06504Help
Entry
VDBG_06504        CDS       T02227                                 

Definition
endo-1,4-beta-xylanase I
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     VDBG_06504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 223 aa AA seqDB search
MVSFTSLLAAFSVVSGILASPIAVVPEVSTALAKRTPSSTGTSGGFYYSFWTDTPNSVTY
TNGDAGKFSVSWKNNNGNHVGGKGWRTGSARTIKYSGSYKPNGNSYLAIYGWTRSPLIEY
YIVESFGTYNPSTGATKKGQFTVDGSVYDLYTSTRTNAPSIEGTRTFTQFWSVRRTKRTS
GSVNTGAHFAAWKKAGMNLGSHDYQILAVEGYKSSGSATMTVS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtctcgttcacttctctcctggccgccttctcggtggtgagcggcattttggccagc
cccattgctgtcgtccccgaggtcagcactgctctggcgaagcgcacgcccagctctacc
ggcacctcgggcggtttctactactccttctggaccgatacccccaacagcgtgacctac
accaacggcgacgccggcaagttcagcgtgagctggaagaacaacaatggcaaccacgtc
ggcggcaagggctggcgtacgggcagcgccaggaccatcaagtactccggctcgtacaag
cccaacggcaacagctacctcgccatctacggctggacccgcagccccctgatcgagtac
tacattgtcgagagcttcggcacctacaacccctccaccggcgccaccaagaagggtcag
ttcaccgtcgatggctccgtctacgacctctacacgagcacccgcaccaatgccccctcc
atcgagggcacccgcaccttcacccagttctggtccgtccgccgcaccaagcgcaccagc
ggctccgtcaacacgggcgcccacttcgccgcctggaagaaggccggcatgaaccttggg
agccacgactatcagatccttgccgtcgagggctacaagagctctggcagcgccaccatg
actgtgtcttga

DBGET integrated database retrieval system