KEGG   Verticillium alfalfae: VDBG_06614Help
Entry
VDBG_06614        CDS       T02227                                 

Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
val  Verticillium alfalfae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VDBG_06614
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VDBG_06614
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDBG_06614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 566 aa AA seqDB search
MAAQAAPNDRTPLLDDTERRENINDDSESNSDNGHSPSSGGSNRLREVLLFVWALLATAA
VIVLAVWSQHNRQTGHGTGPTPEKRNLIFMHVEGLSEDDTLTLDKHFWGTSPHALLQLAR
HRQRAVHGLLVRQERATTAPSHHARVRALRHRSRGWQEGRLCDGAGRDHRHHRRHACLLR
QHVLTRAMNDDIALQEVGDGPLGRVVDLMLGGGRCHFLPNGTADSCRLDETDVVKIAQEK
YNWTYASDRAGFDALKLGENVQLPALGLFAHYNVPFEIDRRNLDHIYPSLTEMTHTALRA
LEKETEHSDHGFFLMIEGSRIDHAGHINDPAAQVHEVLQYDAAFQAVLDFIEKSETETIL
VATSDHETGGLGTALQEPGHLPVYNWFPRALAKANASSEFLSLQLAKHIAENPGEHMGKL
RSWVNETLIYGGLGITDVHPEELDALVEAPLAAITTFAAIISLRAHVGWSTHGHTAVDVN
IYSSGGRDTEKIRGNVENTDVGKFLRDWLDLDVAPITEELKSKLGKVNRNDLAAMDAVSG
RPAEAAAAGEVPQHWMEQHMREVAAI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcaagcagcaccaaacgaccgaactcccctcctcgacgacacggaacgtcgt
gagaatatcaacgatgactccgagtccaactccgataacggccactccccttcatcaggc
ggatcgaaccgactgcgtgaggttctcctcttcgtctgggccctgttagcgactgctgcc
gtgatcgtcctcgcggtgtggagccagcataaccgccagacgggacatggaactggtccg
acgccggaaaagcgaaacctcatcttcatgcacgtcgagggtctttccgaggatgacact
ctgacgcttgacaagcacttttggggcaccagcccgcacgcgctccttcaactcgctcgt
caccgacagcgcgcggtgcacggccttctcgtgcggcaagaaagagctacaacggcgcca
tctcatcacgcccgagtacgagccctgcggcaccgttctcgaggctggcaagagggccgg
ctatgcgacggggctggtcgtgaccaccgacatcaccgacggcacgcctgcctgcttcgc
cagcatgttctgacccgcgccatgaacgatgacattgccctgcaggaggttggtgatggc
cccctcgggcgtgttgtcgacctgatgcttggcggtggccgctgccatttcctgcccaac
ggcaccgccgacagctgtcgcctagacgaaaccgatgttgtcaagatcgcacaggagaag
tacaactggacgtatgcgagcgaccgagcgggattcgacgccctcaagcttggcgagaac
gttcagctgccggcccttggcttatttgcccactacaatgttccctttgagattgaccgc
cgcaacctcgatcacatttaccccagcttgaccgagatgacccacactgcgctccgcgcg
ctggagaaagagacggagcacagtgaccacggcttcttcctcatgattgaaggcagcagg
attgaccacgccggacacattaacgatcccgcggctcaggtccacgaggttctgcagtac
gatgctgccttccaggccgtgcttgactttatcgagaagagcgaaaccgaaacaattctg
gtagccacgagcgatcacgagacgggcggtctcggtactgctctacaggagcctggacac
cttcccgtctataactggttcccccgcgcccttgccaaggccaatgcttcgtccgagttc
ctgtccctgcagcttgccaagcacattgccgagaacccgggcgagcacatgggaaagctc
aggagctgggtcaacgagacgctcatctacggcggtctcggcatcacagacgtgcaccct
gaagagctcgacgctctcgttgaggcgccccttgccgcgatcacaaccttcgctgccatc
atcagcctgcgggcgcacgtgggctggagcacgcacggacatacggccgtcgatgtcaac
atttacagctcgggtgggcgcgacacggaaaagatccgcgggaacgtcgagaacacggac
gttggcaagttcctgcgtgactggctcgacctcgacgtcgcgcccattaccgaagagctg
aagtccaagctcggcaaggtgaataggaacgatctcgcggccatggatgccgtttcgggt
aggcccgcagaggcggcggccgcgggcgaggtgccacaacattggatggaacagcatatg
cgcgaggtggcggcgatctaa

DBGET integrated database retrieval system