KEGG   Verticillium alfalfae: VDBG_06639Help
Entry
VDBG_06639        CDS       T02227                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
val  Verticillium alfalfae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_06639
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    VDBG_06639
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     VDBG_06639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 293 aa AA seqDB search
MPVLASARYGKDNVRVFKVQKDGPVQTVTEMTVCALLEGAIETSYTVADNSVVVATDSIK
NTIYIKAKEHPINPPELYASILGTHFLDTYAHISVANIRVTVHRWTRLDVDGKPHPHSFL
RDGEETRTVEARVTRDGVALTSGIQKLTVLKSTGSAFHSFVRDEYTTLPETWDRILSTDV
DASWTWTFPEGLAAVEKDVTRFDAAWDAARAITLKTFAEDESASVQNTMYKMCEQILDAA
PETKTVSYALPNKHYFEIDLSWHKGLKNTGADAEVYAPQSGPNGLIKCEVARS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcctcgcttctgcccgctacggcaaggataatgtccgcgtcttcaaggtccag
aaggacggccccgtgcagaccgtcaccgagatgaccgtctgcgctctcctcgagggggcc
attgagacgtcgtacaccgtcgccgacaactcagtcgtcgtggccaccgactcgatcaag
aacaccatttacatcaaggccaaggagcatcccatcaacccgccggagctctacgcctcc
atcctcggcacccacttcctcgacacgtacgcccacatctcggtcgccaacattcgcgtc
accgtccaccgctggacgcgcctcgacgtcgacggcaagccgcacccgcactcgttcctg
cgcgacggcgaggagacgcgcaccgtcgaggcccgcgtcacccgcgacggcgtcgccctg
acgagcggcattcagaagctcaccgtcctcaagtcgaccggctcggccttccacagcttc
gtccgcgacgagtacaccaccctgcccgagacctgggaccgcatcctctccaccgacgtc
gacgcctcctggacctggaccttccccgagggcctcgccgccgtcgagaaggacgtcacc
cgcttcgacgccgcctgggacgccgcccgcgccatcaccctcaagacctttgccgaggac
gagagcgccagcgtccagaacaccatgtacaagatgtgcgagcagatcctcgacgccgcc
cccgagaccaagaccgtctcctacgccctgcccaacaagcactactttgagatcgacctc
agctggcacaagggcctcaagaacacgggtgccgatgccgaggtctacgccccgcagtct
ggccccaacggcctcatcaagtgcgaggtcgctcgttcgtag

DBGET integrated database retrieval system