KEGG   Verticillium alfalfae: VDBG_06737Help
Entry
VDBG_06737        CDS       T02227                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
val  Verticillium alfalfae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VDBG_06737
   00500 Starch and sucrose metabolism
    VDBG_06737
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     VDBG_06737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MKTFAALCTLLASAQAATRTSAPSGCITVSKSPASGQFGTIQAAVNSLSTSSSGTQCIFI
NQGSYAEQVLVPSRSAQLTIYGYSTDTSGYAGNKVTITANKSQKDGLNNDETGTLRVKAN
NFKLYNVNVANTYGKGSQAIALSAYADSGYYGCAFTGFQDTLLSNTGYQLYSRSLIQGAT
DFIFGRQASAWFEKCDLRVLSASKGWITANGRDSSSNPSYYVFNNCNIAAASGNSVSAGA
YYLGRPWGAYSRVAFQKTTMSSVINSAGWSVWNTGDERTSNVAYGEYQNTGAGASGTRAS
FSKALSSAVSISTILTSSYASKGYYDASYM
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtttgccgctctctgcactctgcttgcttcagcacaagctgccacgaggacc
tcggccccatcggggtgcattaccgtcagcaaatctccggccagtggacagttcgggacg
atccaggctgctgtgaactccctgtcaacgtcgtcctcgggcacacagtgcatcttcatc
aaccagggctcctacgccgagcaagtcctcgtcccgagccgcagcgctcaactgaccatc
tatggctacagcacggacaccagcggctacgccggaaacaaagtcaccattacggcgaac
aagagccagaaggacgggctcaacaacgacgagactggcaccctgcgcgtgaaagccaac
aacttcaagctgtacaacgtcaacgtcgccaacacgtacggcaagggaagccaggccatc
gccctgagcgcctacgccgacagcggctactacgggtgcgccttcaccggcttccaggac
acgctcctcagcaacaccgggtaccagctgtactcgcgctccctgatccagggcgccacg
gacttcatctttggccgccaggcttctgcgtggttcgaaaagtgcgacctccgcgttctc
agtgcctcgaagggctggatcactgccaacggacgtgattcctcgtccaacccatcatac
tacgtgttcaacaactgcaacatcgctgctgcctccggcaacagtgtgagcgctggggcg
tactatctcggccgtccgtggggcgcctactcccgtgtcgcgttccagaagacgacaatg
tcgtccgtcatcaactcggcggggtggtcggtctggaacacaggcgatgagaggaccagc
aatgtcgcgtacggcgagtaccagaacacgggcgccggcgcctcgggcacccgagcgagc
ttttccaaggccctttcgtcggccgtctcgatctcaaccatcttgacgagcagctatgct
agcaagggttactatgacgcttcgtacatgtga

DBGET integrated database retrieval system