KEGG   Verticillium alfalfae: VDBG_06806Help
Entry
VDBG_06806        CDS       T02227                                 

Definition
bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
val  Verticillium alfalfae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    VDBG_06806
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    VDBG_06806
   04113 Meiosis - yeast
    VDBG_06806
Protein phosphatases and associated proteins [BR:val01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     VDBG_06806
Ubiquitin system [BR:val04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     VDBG_06806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 835 aa AA seqDB search
MAPSSTAITGLLRQVVYYHLDNNSYENALFFAEKLAAQDPKASESTHLLSLCHFRLGDHR
SAFDFSRASANRGSNLGTIWVFAQSCLHLERYRDGISVLEKTRDRWVNKSHLGKHTAVAR
SMCPDEATVLCLLGKLYRAYDDRKKAAECFENALKTNPFMFDAFQALCDLGVTVRAANIF
RVNDTLTQAFTQGLMAASADLKDSSAVNFLEPTTKKASARNVMEVADPFELSRVPGHHDT
AFALSAGPAESEENDFMSKITAARTRLAHPLAGNGSIDVMETPTGPLPVVDAHAARTASN
FAVSDVPPAAPTRRTRTAPAPQTEGAFMEAPPPRMGYRLGAKRAVRSQDKGQEQPIETLP
DQLSGLSRSSAVAAERKRTVSGHPVVSRQQSEEPVTRRSARLNMFKPSAAKTNSGASTIG
ATATRELKKARPPISRAFRPGSSGSSVGRVVSGNRNPRQEEHSMDVDHAETSRVKEPPAV
QAAVVKPPPQEPDHLKIEESLKWIMDLLRKTGTGYFAASQFRGHDAVQSYSSLPRSQQET
PWVLAQVGKAHYEQAAYVEAEKYFRKLRVLAPSRMEDMEVYSTILWHLKRETDLSFLAHE
LIDSEWLAPQAWCTLGNAWSLAREPDQALRCFKRATQVDPKFAYAFTLQGHEHVANQEYE
KALGAYRQAITADQRHYNAYYGMGKVHEKLGNYDKARIHFHTASMINPTNAVLICCVGSV
LEKQKQMGLALQAFTKATELAPRAAQTRYQKARALLAVGQLEAAQKELLILKDLAPDEAN
VHFLLGKMYIRTGEKQSAVRHFTVALALDPKASPQVKEAIESIEDDQGMEDSLMT
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggccccgtcaagtacagccatcactggtcttcttcgccaggtcgtatattaccacctc
gacaacaactcctacgagaatgcactcttctttgccgagaagcttgctgcccaggacccg
aaagcgagcgagtccacacatcttctctccttatgccatttccgactcggcgaccatcga
tcagcctttgacttcagtagggcgtctgccaaccggggatctaacctgggcacaatatgg
gtctttgcccaatcatgtcttcacctggagcgctaccgcgacggcatcagcgttcttgag
aagacacgcgatcgctgggtgaacaagtcgcacctcggcaagcataccgcagttgcgcgg
tcgatgtgcccagacgaggctactgtgctatgcttactcggcaagctttaccgcgcatac
gatgatcgcaaaaaggctgccgaatgctttgagaatgcactcaaaactaacccgttcatg
ttcgacgcattccaagctctttgtgatcttggtgtcaccgttagggcagccaacatcttc
cgagtcaacgatactctcacgcaagccttcacgcagggcttgatggctgcttcggcggat
ctcaaagacagctcggccgtcaacttccttgagcccacgacgaagaaggcctccgctcgt
aatgtgatggaggtggcagatcctttcgagctatcacgtgtgcccggccaccacgacaca
gcatttgcactgagcgcgggtcctgcggagtcagaggagaatgatttcatgtccaagata
acagctgccaggacacggctggcgcatcccttagcgggcaacgggtccatcgacgtcatg
gaaacaccaacgggtcctctaccagtggtcgacgcgcatgctgcacgcacggcctcgaat
tttgcagtcagcgacgtaccaccagcggcaccaacccgtaggaccagaacagcacctgcg
ccgcaaaccgagggtgccttcatggaggcaccgcccccaaggatggggtaccgtctgggc
gcgaagcgagctgtgcggtcccaagacaagggccaggagcagcccattgagactcttcct
gatcagctgagcggcctgtcgcgatcgtcagctgttgcagcagaaaggaaacgaacggta
tccggccacccagtcgtctccaggcagcagtccgaggagcccgtcacccgaagaagtgcg
cgcctcaacatgttcaagccgtcagccgccaagacgaactccggcgcatccactatcggt
gccacagccacccgggaactgaagaaggctaggccccctatctcccgggcattccgtccc
ggatctagtggctccagcgtgggcagagttgttagcggcaaccggaacccccgtcaagaa
gagcatagcatggatgtcgaccacgccgagacctcacgtgttaaagagcctcccgctgtc
caagcagctgtcgtcaagccgcccccccaagagccggatcatctcaagattgaggagtct
ctgaagtggatcatggacctgctgagaaagacagggaccgggtacttcgctgcctcacag
ttccgcgggcacgatgcagtgcagtcttacagcagcttacccaggagccagcaggagacg
ccttgggtcctggcacaagtaggaaaagctcattatgagcaagcggcgtacgtcgaggca
gagaagtattttaggaaactgcgagtcttggcaccttcgcggatggaagacatggaggtc
tactctacaatcctgtggcacctcaaacgcgagactgatctctcgtttttggctcacgag
cttatcgactcggaatggctggccccgcaagcgtggtgcacgctaggaaatgcatggtcc
ttggcaagagagccggaccaagcgttgcggtgcttcaaacgggcgactcaggttgacccc
aagtttgcctatgcctttacgttgcagggtcacgagcacgttgcgaatcaagagtacgaa
aaggcactgggagcgtaccgacaggcaattactgccgaccagcgccactacaacgcttac
tacggcatgggcaaggtgcatgagaagctaggcaactacgacaaggctaggatccacttc
catacggcgtccatgatcaacccgacgaatgcagtgctcatctgctgcgtgggcagtgtc
cttgaaaagcaaaagcagatgggcctggcactccaggccttcaccaaggccaccgagttg
gcaccacgagctgcgcagactcggtaccaaaaagctcgagctctgctggctgtcggccag
cttgaagccgcgcaaaaggaacttttgatactcaaagatttggcccctgacgaggcaaac
gtgcatttcctcttgggtaagatgtacattcgcactggcgagaagcagtcggccgtgcgg
cacttcaccgtcgctctcgcactggatccgaaggcaagcccacaagtcaaggaggcgatc
gaaagtatagaggacgatcaggggatggaagactccctcatgacttga

DBGET integrated database retrieval system