KEGG   Verticillium alfalfae: VDBG_06834Help
Entry
VDBG_06834        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
val  Verticillium alfalfae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VDBG_06834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1471 aa AA seqDB search
MAEITTLVALQSFHRDLVAIREGRPENTESWDNSLVQELFKRELSRLWQRPARDEKSRSQ
VKSGKVFIDEEEYSVNEEFQQIALNLADEAEVNEIEAARYVLEAEEDTATLGRPLLECAI
IRFHQQRKYILDSLRLMFEVDDLDDDEADPEVVNVIQAYLADNVLKDVNRKKLLPRCMSA
MQDVRSWLARIADKMTAAAVLMNGQNREKPEGLETLEFSRASLVQQHELLAVVLCCAVEK
KEAETADFRGFLDQLRKADKYDVLTVHLFPALGAYITTFGSTEGIGDLTVARELHNVICR
PNDDSSWPLVNLQAAVKAWWVAEYSGWYLDDGLLGGLQGVDLDADVNSAEQQDPSRAALL
KWLARKTPSLVFDTVPFSSFFKACLTAQLEVFVDAFISNLPDVLRKLRSEEDEQRQLSQA
HEQDTDLERFLLIIAMSYEDRSDAATSFWLDPDSNLAGFMHWASRRASTPLVTAFCNMLQ
AVSGNDTCATAAHDFLLDEGHHASGKMRRSQSLTWHQIFRELTFFANKTRDTPPTSQTTL
YRSGRPPTVQAEAEPESEMMLQAYLGLITKLTSESETARQFLLKEPNYNLVEVCYQLASS
PILPHIRASVFTALRGLLTHKSQEEGHIMWTCLESWMGGGYVVFPPGHHRPPLNPPEDVQ
QKIGDELVSTPEEGIAFIQFLTSLVTPSEESSSLNDSLPFPETLGSAFRMPGIEIYVDLV
LATLSSPKIIDANDIYQARLLRLSCLEFAFVCLATFNEDLIILANQTNIQLDAAIATTDL
ATYVRLHPFARVMEWMFNDSTVNALFKIIHQDATEVGNASPDAPIITSILRSVEVISKVL
DLQSTYVELVRPVIKSKSSHRRQNVSNAAFASFEDGLASHLNLVVDLGSYCGIGHPDVTL
ACLKLLERMSSAPKITSAWTLTSGRQTQRNRAIIAMEANGDDEAISRSLASELTTSFDLG
REAESPNYVTKVYILDFLYSCLAAMPNQPTIAHLLLGFQCGVETLTVDANGTFSERTSLF
HAVLRLLLETPSGDNQGMRSWLITLKFKCMRILRILWNSSLSASFVIDELRENDVLFHLL
LRDVVIQPALAWEGEDINQPHFPLTNGATTLVDFLALRSMTLEYIAMELCSISQSRLPSA
KRRIFEALNGRLQGDENEIITIPTVYDLYDFLLPDGMWDNLEPAVQFYKGLDLSTCFEQD
ADDNSVANIERVKDILQLKRSERRGEGVLLTAQDFTVIEQEEASIVEHLVSSHRENLIAS
GRLRPVDKENQNIGSLVSDKLSNCSKFAQAIGKWAGTSDIRAIYYSICYRYLTGMVDEGM
LVAERPKTMRTIQMYGERLISIICDDAYGSEPDSQTAAMILLNALVNFSRAEDSPHVIET
LNRLNFIGIVIDSLRNVHEEWSHIIKTEDKAQETYLSSKLALLLQLAQTRMGAKYVLHAN
LLRALELSGLFAADPELQSDRAKAPRTGEAL
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcactaccctggtcgcgctgcagtctttccatcgcgacctcgtcgcaata
cgcgaaggacgtccggaaaacacagagtcctgggacaattcacttgtgcaggaacttttc
aagcgcgagctgtctagattgtggcagcggccggcgagagacgagaagagtcgctctcag
gtcaagtcaggcaaggtcttcattgatgaggaagaatactccgtcaacgaagaattccag
cagattgctcttaatttggcagacgaagccgaagttaacgagatcgaagccgctcgatat
gttctcgaagccgaagaagacaccgcaactctaggacggccactgctcgaatgcgccatc
atcaggttccaccaacagcggaaatatattctggacagtttgcggttgatgtttgaggta
gatgatctggacgacgatgaggcagaccccgaggtggtcaacgtgatccaggcatatttg
gcggataacgttctcaaggatgtcaaccggaagaaactcttgcctaggtgcatgtccgcc
atgcaagatgtacgctcttggctcgcaaggatcgcggacaagatgactgcggcagcagtc
ttgatgaacggtcagaacagggaaaagcccgagggactggaaacgctcgagttctcccgg
gcgagtcttgtccagcagcatgaacttctggctgttgtcctatgctgtgccgtggaaaag
aaggaggcggagacggctgacttccgtggcttccttgaccagctcagaaaggcggacaaa
tatgacgtcctcacggtgcatttatttcctgccctcggtgcttatatcacaacttttggc
tcaacggaaggtatcggggacctcacagtcgcgcgggaacttcataatgttatctgccgc
cccaatgacgacagttcctggcctctggtaaacttgcaagcagctgtcaaggcttggtgg
gttgccgagtacagcggatggtacctggatgacggactcctcggtggattgcaaggcgtc
gaccttgatgcagatgtcaacagtgcagagcagcaggacccgtccagagcggcgttgctc
aagtggctagcccgcaagacaccatcgctggtattcgacactgtgccattctccagcttc
ttcaaggcttgcctcaccgctcagttagaggtgttcgttgatgctttcatttccaatctc
cctgacgttctgcgaaagcttcgcagtgaagaggacgaacagcgacagctcagtcaagca
cacgaacaagacacagatctcgagcgcttcttgcttataattgccatgtcatacgaggac
cgatcggacgcagctaccagcttctggctcgaccctgacagcaacttggcgggctttatg
cactgggcgtcgcgacgagcttccacacctttggttacagccttctgcaacatgctgcag
gcagtttccgggaatgacacctgtgctactgctgcccacgactttttgttggatgaggga
catcacgcatctggaaaaatgagaagatcacagtctttgacgtggcatcaaatcttcagg
gaactcacattcttcgccaacaagactcgagatacgccaccaacatctcagaccacactc
tatcgatctggtaggccgcccacagtgcaagctgaagcagaaccagagtcggaaatgatg
ctacaggcctacctaggcttgatcaccaagcttacatcggagagtgaaacggccagacaa
tttttacttaaggagcccaactacaatctggttgaggtctgctatcagctcgccagcagt
cctattcttccccacatccgagccagcgtcttcactgctttgcgtggtctcctaacgcac
aagtctcaagaggaaggtcacatcatgtggacttgtctcgagagctggatgggcggcggt
tatgttgttttccctcctggacatcaccgacctcctcttaaccctcccgaggacgttcag
caaaagatcggtgatgaattggtctctacgccggaggaaggcatcgctttcatacaattt
ttgacttcattggtgacgccttcagaagaaagcagttccctgaacgactcactacctttt
cccgagacgctgggctcagcattccgcatgcccgggatcgagatatacgtggacctggtt
ctcgcgaccttgtcttcacccaagattattgatgccaacgacatctatcaggcgcgactg
ttgaggctcagctgcctcgaattcgcattcgtttgcttggcaacattcaatgaggacctc
atcatattggccaaccagacgaacatacagctcgatgcggcaattgccactaccgatctt
gcgacttatgttcgactccatccttttgcacgcgtaatggagtggatgtttaacgacagc
actgtcaacgctcttttcaagatcattcaccaagatgcgactgaagttgggaatgcttct
ccagatgcacccatcatcacaagcattttgcgctccgttgaggttatctcgaaagtcctc
gacctccagtcgacctatgtcgaacttgtgcgaccagtcatcaagtctaaatcgagccat
cgaaggcagaatgtgtccaatgcagcgttcgcgtcctttgaggatgggttggctagccat
cttaatcttgtcgtagacctcggcagctactgcggtatcggccaccctgatgttacactg
gcttgtctgaagctgcttgagagaatgtccagcgcccccaaaatcacatcggcgtggaca
cttacatccggacggcaaacacagcgaaacagagccatcattgcgatggaggccaacggc
gatgatgaggcgatttcacgctcactggcttccgagctaacgacatcgtttgatctgggc
agggaggctgagtcaccaaactatgtgaccaaggtttacatcctcgacttcctttacagt
tgtctggctgcgatgccgaaccaacctaccatcgctcacctgttgcttggcttccaatgc
ggcgtcgaaaccttgaccgtcgatgcgaatggcaccttttcggagcggacttcactcttc
cacgccgttttgagactgttgctggagaccccctctggggacaaccagggcatgcgatcc
tggctcatcacgctgaagttcaaatgcatgcggattttgcgcatcctctggaactcctcc
ttgtcagcatccttcgtcatcgatgaactgcgagagaatgacgtcttgttccacttgctt
ctgcgggatgttgtcatacaacccgccctggcttgggaaggcgaagacattaaccagcct
catttcccgctgactaatggtgctactaccctcgtcgatttcctagccctacgcagcatg
accctggagtatatcgccatggagctttgtagtatttcacaaagtcgacttccgtctgcg
aaacgtcgcattttcgaagccttgaatgggagacttcagggtgacgaaaacgaaatcatc
acaatcccaacggtgtatgacttgtacgacttcctgctgcctgatggcatgtgggacaac
ttggagcccgccgtgcaattttataaaggcctggatctgagcacatgctttgaacaggat
gcggatgacaactctgttgccaacatcgagcgcgtcaaggacattttgcagctcaagcga
agtgagagacgcggcgagggcgttctgctcacagctcaggactttaccgtcattgaacag
gaggaagcttcaatagttgagcatcttgtgtcatcccatcgagagaacctcatcgcttcc
gggaggcttcgaccagtcgacaaagaaaaccagaacatcggcagcctggtcagcgacaag
ctctccaactgttccaaattcgctcaggccattggcaaatgggccggcacctccgatatc
cgagccatctactatagtatctgctatcgatacctgaccggaatggtggatgaaggcatg
ctcgtggccgagcgaccaaagacgatgcgcacaatccaaatgtatggcgagaggctaatc
agcatcatctgtgacgacgcgtatggcagcgagccggacagccagacagctgccatgatc
cttctgaatgcgctggtcaacttcagccgcgcagaagatagccctcacgtcatcgagaca
ctcaataggctcaactttatcggtatcgtcattgattcgcttcgcaatgtccacgaggaa
tggtcccatatcatcaagaccgaggacaaggcgcaggaaacttatctgtcgtccaagttg
gccctgctcctgcagttggcacagacccggatgggtgcgaaatatgtcttgcacgcgaac
ctgctcagagcgctcgaattgtctggcctctttgctgcggaccctgagctgcagagcgac
agagccaaagccccgcgcactggagaagcactatga

DBGET integrated database retrieval system