KEGG   Verticillium albo-atrum: VDBG_06855Help
Entry
VDBG_06855        CDS       T02227                                 

Definition
nitrate reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
val  Verticillium albo-atrum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_06855
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     VDBG_06855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MADALGSKKFVDGVYIPVVLMIVGTLIVKREWTPYTVLVALALGSWKFFSLKIKKVLKPD
VYQEFELKEKTIISHNVAIYRFSLPSPTSILGLPIGQHISIGEVLAQPDGTHKEIVRSYT
PISGDHQPGYFDLLIKSYPTGNISKHMASLKVGQPIRVKGPKGAFVYTPNMVRHFGMIAG
GTGITPMLQVVRAIIRGRAAGDTTQVDLIFANVTQQDILLKEDLDALAKEDSGFRVHYVL
DKAPEGWTGGVGYVTADMITKWLPEAAPDVKLLLCGPPPMISGLKKTAVTLGFEKARPVS
KLADQVFAF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcactgggctcgaagaagtttgtcgacggggtttacatccccgtcgtcctg
atgatcgtgggcaccctcatcgtcaagcgcgaatggaccccctataccgttctcgtggcg
cttgctctgggcagctggaagttcttcagcctgaagatcaagaaggttctcaagcccgac
gtctaccaagagtttgagctcaaggagaagaccatcatttcccacaatgtcgccatctac
cgcttctcgctcccctcgcccacctcgatcctcggcctccccatcggccagcacatctcg
atcggcgaggtcctcgcgcagcccgacggcacccacaaggagattgttcgctcctacact
cccatctcgggcgaccaccagcccggctacttcgaccttctcatcaagtcgtaccccacg
ggcaacatctccaagcacatggcctccctcaaagtcggccagcccatccgcgtcaagggc
cccaagggcgcctttgtctacacccccaacatggtgcgccacttcggcatgattgccggc
ggcacgggcatcacgcccatgctccaggtcgtccgcgccatcatccgcggccgcgctgcc
ggtgacacgacccaggtcgacctcatcttcgccaacgtcacccagcaggacattcttctc
aaggaggacctcgacgcccttgccaaggaggacagcggcttccgcgtccactacgtgctc
gacaaggcccccgagggctggaccggcggtgttggctacgttacggccgacatgatcacc
aaatggctgcccgaggcggctcccgacgtcaagcttctgctgtgtggtcctcccccgatg
atcagcggcctcaagaagacggccgtcacactcggcttcgaaaaggcccgccccgtcagc
aagctggccgaccaggtcttcgccttctaa

DBGET integrated database retrieval system