KEGG   Verticillium alfalfae: VDBG_07006Help
Entry
VDBG_07006        CDS       T02227                                 

Definition
dual specificity protein kinase YAK1
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     VDBG_07006
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   VDBG_07006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 952 aa AA seqDB search
MDSQWQQSYADSGASSRRYNNGAAQIPRDYAGQVPPQGHSHTHSQGHIQGQNQPPAGFKY
EQYQQSPGAAPLCCFAHGLASGRTTSLTYLAAVLPTCTRPRNLRPPRRGTPPWRPYRPRL
PTRPSPPVQGQFVSPPDQRQSPTRQQSDYNPQSPYYAGRQQAPQLPPITPYTSTHDGYPS
SAVANLDGAFAAADPKSPRRPVAALNKSVVPEFKPVRALTDLRPKVSAQPPFRRANPEGG
FHQCKNQYVTESICGITASTANVRPCSLCKALTVHLPATYRICNPNFKYESSRNPRRVLT
KPSKGVKNDGFDNEDSDYILYVNDILGSEEAGHNSTPNWIRMMITTSCDSKDTFIHRQHL
CLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKARLIHCDLKPENILLK
NLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELFL
GLPLFPGSSEYNQVSRIVDMLGNPSNWMVEMGKQAGEFFEKRQDEFGRRTYQLKPMEQYA
REHSTKEQPSKKYFQANTLPDIIKTYPMPRKNMKQNEIDREMNNRIAFIDFVRGLLNINP
LERWSPQQAKLHPFITQQKFTGPFVPPMNLKSSSLNRSPAPGTQQQQQAEALSKQRAQAA
QAQAHSAAQGAYASMNAQYQQAGHAPATQSMYGSNVMYSPGGNHAPQPPAYGPQPGGYGQ
QQVVLSQAPQQMPAAPYGQQPNINQGGLYPQNNMRPGRQRASTMDQQQSGIPAAIQRVAS
HLDPSQPIRLQPSPAYYPPPGEVRRTRAGTCRNSRPEPGQKLTKSRASMWRKGRRREHGP
DKLAPGTYVLLTATTTTRPRPDRNHVWRCWQQKLEIKRMDTMNDDETDGRAGGRTGGRNI
AASYNVDGGHWRLSSLPRRYRQRGDCGRVGRGMTLSKGSLNRLCTLDPIQAD
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaatggcagcagagctacgctgactcgggcgcctcctcgcgacgatacaac
aacggcgctgctcaaattcctcgcgactacgctggtcaggtccccccccaaggtcatagt
cacacccacagccagggccatatccagggccagaaccaacccccagccggcttcaagtac
gagcagtatcagcaaagtcccggcgccgcccccctctgctgcttcgcccatggcctcgcc
tcaggccgcaccaccagtctcacctatctggcagccgtcctgccaacctgcactcgcccc
aggaaccttcggccgccgcgcaggggtactcccccatggaggccttatcgcccacgtctc
cctacgcggccaagtccccccgtccaaggtcaattcgtcagcccccccgaccagaggcaa
tcgcccacgagacagcaatccgactacaaccctcagagtccctactacgccgggcgccag
caggctcctcagctgccccccatcacgccctatacctcgacccacgatggatacccatcc
tcggctgtcgccaacctcgatggagctttcgccgctgctgatcccaagtcaccccgtcgt
cccgtcgccgcgctcaacaagagtgtcgttcccgagttcaagccggttcgtgctctgacc
gaccttcgaccaaaagtcagcgctcagccgccgtttcgccgagcgaaccccgaagggggc
tttcatcagtgtaagaatcaatatgtcacagaaagcatttgcggaattacagcatccacg
gctaacgttcgaccatgcagcctctgcaaagctctcacagtccaccttccggccacctac
cgcatctgcaaccccaacttcaaatacgagtcgtcgcgcaatccccggcgtgttctgacc
aaaccgagcaagggtgtcaaaaatgacggtttcgacaacgaagacagcgattacatcctt
tatgtgaatgatatcctcggctcggaggaggctggtcacaactcaacaccaaactggata
agaatgatgatcaccacctcctgcgactcaaaagacacattcatccaccgccagcatctc
tgcctcgtgttcgagttattgagtgtcaacctctacgaactcatcaagcagaaccagttc
aggggactcagcacgaccctcgttcgcgtcttcgcccagcagctgctcaatggccttgcg
cttctcaacaaggcccgcttgatccactgcgacctgaagcccgaaaacattcttttgaag
aacctggagagccctatcatcaagattattgatttcggctccgcgtgtgacgagcgccag
actgtgtatacatacattcagtctcgattttaccgttctcccgaagtcctgctggggtta
ccgtattcgtctgccatcgacatgtggtctcttggctgcatcgtggtcgagctgttcctg
ggtctccccctcttccctggatcgtccgagtacaatcaagtctcacgaatcgtcgacatg
ctcggcaacccgtccaactggatggtcgaaatgggaaaacaggccggcgagttctttgag
aagcggcaggacgagtttgggcgccgcacatatcagctcaagcccatggaacaatacgca
cgggaacactcaaccaaggaacagcccagcaagaaatacttccaggcgaacactcttccg
gacatcatcaagacttatcccatgccgcggaagaacatgaaacagaatgagatcgacagg
gaaatgaacaaccgcatcgctttcatcgacttcgtccgcgggctgctcaatatcaacccg
ctagagagatggtctccccagcaggctaagctgcacccttttattacccaacagaagttc
actggtccctttgtaccccccatgaacctcaagtcgagctcgcttaacaggtccccggct
cctggtacgcagcaacagcagcaagcagaggcgctgagcaaacagcgtgcccaggcagcc
caggcacaggcccactcggcggcgcagggggcttatgcatcgatgaacgcgcaataccag
caggccggacacgccccagcaacgcagtccatgtatggtagtaacgtcatgtactctcct
ggcggcaatcacgccccacagccgcctgcctatggcccgcagccgggtggttatgggcaa
cagcaggtggtcttgtctcaggcgccgcagcagatgcctgcagctccttatggccagcag
cccaacatcaaccaaggcggtctctacccgcaaaacaacatgcgccccgggcgccagcgg
gcttcgacaatggatcagcagcaaagcgggatccctgctgccatccagcgcgttgctagc
caccttgaccctagtcagcccatcaggcttcaaccgagcccagcatactacccgccaccg
ggcgaagtaagacgtacaagagccggcacgtgtaggaactccaggcctgagcccggtcag
aagctcacgaaatcaagggcatcgatgtggaggaagggccggcgcagagaacatggcccg
gacaaattggcgccagggacatacgtgcttttgactgcgacaacgacgacgcggccccga
ccagatagaaaccacgtgtggcgctgctggcagcagaagctggagatcaagaggatggat
accatgaacgatgacgaaacggacggacgggcgggagggcggacgggaggcagaaacatt
gcagcatcttataacgtggatggagggcattggcggctttcttctcttcctaggaggtac
cgccagagaggggattgtgggagggtaggacggggaatgactttgagcaaagggagcctc
aacaggctttgtactttggatcctatccaggctgattaa

DBGET integrated database retrieval system