KEGG   Verticillium alfalfae: VDBG_07031Help
Entry
VDBG_07031        CDS       T02227                                 

Definition
sphingosine N-acyltransferase lac1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
val  Verticillium alfalfae
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VDBG_07031
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     VDBG_07031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MEGSVEPFPLLNTSADPVVDTTAARRRRKSSALGQDIRAGDTGAPALASSRQSLSAVDRP
SPSPSISSASSANNTAMTSSSPAEPSAQTAARRISKRRRARGLLARARQAMIKRTYLLPA
VILTIFGFLYALNPTESNPVHRFIFLSYRLDHGSGHPLAPTDPDTPVQYGKGPRDIAFVA
FYTVVLSFTREYIMQELIRPLARRAGLRSRAKQARFMEQMYTAIYFFFLGPAGMYVMSST
PVWYYNTAGMYENFPHRTHAAGFKFYYLFQAAYWAQQAIVLLLGMEKPRKDFKELVGHHI
VSLALIALSYRFHFTYIGLAVYITHDISDLFLATSKLLNYIDHPLTGPYFAVFMFVWIYL
RHYINLRIIWSLLTEFQTIGPFELNWATEQYKCRISQVITLGLLSFLQGLNLFWLFFIVR
IAYRFLRDSKATDDRSEDEDDELEELDEDEKKKLVEDDKKARAVNKVSEKTAANGASR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagggctccgtcgaaccatttcccctcctcaacacctcggccgaccccgttgtcgac
acgaccgccgctcgccgccgccgaaagtccagcgctctcggtcaagacattcgcgccggt
gacacgggcgctcctgccctcgcctcgtcccgccagagcctctctgctgtcgaccgcccg
agccccagccccagcatcagctctgcttcgtccgccaacaacaccgccatgacctcctcc
tcacccgccgagccctcggcccagacggccgcccgccgcatctccaagcgccgccgcgcc
cggggcctcctcgcccgcgcccgtcaggccatgatcaagcgcacctacctgctgcccgcc
gtcatcctgaccatctttggctttctctacgccctcaaccctaccgagtccaaccccgtc
caccgcttcatcttcctctcctaccgcctcgaccacggctccggccacccgctggccccg
accgaccccgacacccccgtccagtacggcaagggcccccgcgacattgcctttgtcgcc
ttttacaccgtcgtcctgtccttcacgcgcgagtacatcatgcaggagctcatccgaccc
ctcgcccgtcgcgccggcctccgctcccgcgccaagcaggcccgcttcatggagcagatg
tacacggccatctacttctttttcctcgggcccgccggcatgtacgtcatgagcagcacc
cccgtctggtactacaacacggccggcatgtacgagaacttcccccaccgcacccacgcc
gccggcttcaagttctactacctcttccaggctgcctactgggcccagcaggccattgtc
ctgctgctcggcatggagaagccccgcaaggacttcaaggagctcgtcggccaccacatt
gtgtccctcgccctcatcgccctcagctaccgtttccacttcacctacattggtctcgcc
gtctacatcacccacgacatcagcgatctcttcctcgccacctccaagctcctcaactac
atcgaccaccccctgaccggcccatactttgccgtcttcatgttcgtctggatctacctg
cgccactacatcaacctgcgcatcatctggtctctcctcaccgagtttcagaccatcggt
ccctttgagctcaactgggccaccgagcagtacaagtgccgtatctcccaggtcatcacc
ctcggcctgctctccttcctccagggcctcaatctcttctggctcttcttcatcgttcgc
attgcctaccgcttcctgcgcgacagcaaggccaccgacgaccgcagcgaggacgaggac
gatgagctcgaggagcttgacgaggatgagaagaagaagctcgtcgaagatgacaagaag
gccagggccgtgaacaaggtcagcgagaagaccgccgccaacggcgcttcgaggtaa

DBGET integrated database retrieval system