KEGG   Verticillium albo-atrum: VDBG_07167Help
Entry
VDBG_07167        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
val  Verticillium albo-atrum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:val00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MTACGCPRPPLSTVPKPVPRWYPPCLSRLRPRPPTHEATKNLPQHGFARSSRWEFLGKSS
EESGTNYSVKLDFGLSSSSLDEKTKAAWGYSFGAIYSVTLDRDALATSLVITNEDDKPFE
LQVLLHTYLRVPDVTAVRLSSLDGASYLDKTESLATKTQSGDLAFTGETDRIYTPLGGPK
VPVVVSDNASGRKLYSLTRDNLDDVVVWNPWEAKAKSMPDFSPDDGWRNMVCVEAGAVKG
WQKLEAGDAFEAAQVIAVGDL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctgtggctgtccgaggccgccgctctcgacggttccaaagcccgtcccgcgg
tggtatcccccttgtctttcccgtcttcggccaaggcccccgacccacgaggccaccaag
aacctgccacagcacggctttgctcgctcctcgcgctgggagttcctcggcaagtcatcc
gaggagagcggcaccaactacagcgtcaagctagactttggcctgtcctcttcgagtctt
gacgagaagaccaaggctgcatggggatacagcttcggtgccatctacagcgtgactctg
gaccgcgatgccctggccacatcgctcgtcatcaccaacgaagacgacaaaccattcgag
ctccaagtccttctgcacacctacctgcgcgttcccgatgtgactgccgtccgcctctcc
agccttgatggcgcctcatatctcgacaagaccgaatcccttgccacgaagacccagtcg
ggcgacctcgccttcactggcgaaacagaccgtatctacactcctcttggcgggcccaag
gttcctgttgtggtttccgataatgcgtcgggccgcaagctctacagcttgacccgcgac
aacctggacgatgtcgttgtctggaacccctgggaagccaaggccaagtccatgcccgac
ttttctcccgatgatggttggcgtaacatggtctgtgtggaagccggtgccgtcaagggc
tggcagaagcttgaagctggtgacgccttcgaggctgcgcaggtcatcgcggtgggagac
ttgtga

DBGET integrated database retrieval system