KEGG   Verticillium alfalfae: VDBG_07167Help
Entry
VDBG_07167        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
val  Verticillium alfalfae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDBG_07167
Enzymes [BR:val01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VDBG_07167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MTACGCPRPPLSTVPKPVPRWYPPCLSRLRPRPPTHEATKNLPQHGFARSSRWEFLGKSS
EESGTNYSVKLDFGLSSSSLDEKTKAAWGYSFGAIYSVTLDRDALATSLVITNEDDKPFE
LQVLLHTYLRVPDVTAVRLSSLDGASYLDKTESLATKTQSGDLAFTGETDRIYTPLGGPK
VPVVVSDNASGRKLYSLTRDNLDDVVVWNPWEAKAKSMPDFSPDDGWRNMVCVEAGAVKG
WQKLEAGDAFEAAQVIAVGDL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctgtggctgtccgaggccgccgctctcgacggttccaaagcccgtcccgcgg
tggtatcccccttgtctttcccgtcttcggccaaggcccccgacccacgaggccaccaag
aacctgccacagcacggctttgctcgctcctcgcgctgggagttcctcggcaagtcatcc
gaggagagcggcaccaactacagcgtcaagctagactttggcctgtcctcttcgagtctt
gacgagaagaccaaggctgcatggggatacagcttcggtgccatctacagcgtgactctg
gaccgcgatgccctggccacatcgctcgtcatcaccaacgaagacgacaaaccattcgag
ctccaagtccttctgcacacctacctgcgcgttcccgatgtgactgccgtccgcctctcc
agccttgatggcgcctcatatctcgacaagaccgaatcccttgccacgaagacccagtcg
ggcgacctcgccttcactggcgaaacagaccgtatctacactcctcttggcgggcccaag
gttcctgttgtggtttccgataatgcgtcgggccgcaagctctacagcttgacccgcgac
aacctggacgatgtcgttgtctggaacccctgggaagccaaggccaagtccatgcccgac
ttttctcccgatgatggttggcgtaacatggtctgtgtggaagccggtgccgtcaagggc
tggcagaagcttgaagctggtgacgccttcgaggctgcgcaggtcatcgcggtgggagac
ttgtga

DBGET integrated database retrieval system