KEGG   Verticillium alfalfae: VDBG_07177Help
Entry
VDBG_07177        CDS       T02227                                 

Definition
lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
val  Verticillium alfalfae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VDBG_07177
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VDBG_07177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 607 aa AA seqDB search
MAKLSHSLLWLAASIAHPAAALPGDVSAVDAVAAKRSEGLSVLSVDIRALPDSPSDREAE
WLPRRRNNTIDPMRELLTRANIPDFDAGAYIDRVRDNATALPNIAIAVSGGGYPLRRRAG
SSAPSSPTTSPPSLIYNQGSDGSSVWRFDRSHLPWARGSPASPILNTGRLLVDRRRRMSP
ARVLAGTPSITDFWGRALSYQLINPPDGGPAYTFSSIADTGAVRRTPDTAVPHPGSRTAV
RPVSASSPSMPPVYEFNPFELGSFDPTTYGFAPLRYLASNFSNGEIARDGECVRGFDQLG
FVMGTSSSLFNAFILQNVTGVAESADIPKFLIESVTNVLDRLDADENDIAQYAPNPFFGW
NPTNDSANHESDQLSLVDGGMDLQNIPLHPLIQPFRAVDVIFAVDSSADTTFNWPNGTAL
RATYDRAGTAIGNGTLFPPVPDAETFVNQRLNQRPTFFGCDANNFTLEDGQSLPPLIVYV
PNAPYTAHSNVSTFNPSYPTAQRDAIIRNGFNAATQGNATVDSEWPVCVACAVLSRSLHR
GNETVPEACTRCFERYCWDGSTDSASVSSFEPGFIIGSDEKEDAAGIVRASFWGVGVSLA
VAALVMW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggccaaactctcgcactcgttgttatggctcgccgcctccatcgcccatcccgcagcg
gcgctccccggcgatgtgagcgctgtggacgcggtcgcggctaagcgctcagaaggcttg
tctgttctgtccgtcgacattcgcgcactccccgattcgccgagcgaccgagaggccgag
tggcttccccgtcgccggaacaacaccattgaccccatgcgcgagctcctcacccgcgcc
aacatccccgactttgacgcaggcgcctacattgatcgcgtgcgtgacaacgccacggcg
ctgcccaacatcgccattgccgtgtctggcggcggctaccctctccggcggagggctggc
tcgtcggctccatcttcgccaacaacttctccaccgtccctgatctacaaccaagggtcc
gatggctcctccgtctggcgcttcgaccgttcccatcttccgtgggcccgaggaagtccg
gcatctcccatcctcaacaccggccgactactggtcgaccgtcgtcggcggatgtcgccc
gcaagggtgctggctgggacaccatcaatcaccgacttttggggccgcgcactctcctat
cagctcatcaaccccccggacggcgggccggcctacaccttctcctccattgccgacacg
ggagcagttcgaagaacgccggacaccgccgttccccatcctgggtcgcggacggccgtg
cgcccggtgagcgcatcatctccctcaatgccacccgtctacgagttcaacccctttgag
ctcggcagctttgaccccacgacctacggctttgcgccgctgcgctacctggcctccaac
ttctccaacggtgaaatcgcccgcgatggcgagtgcgtccgcggtttcgaccagctgggc
ttcgtcatgggcacctcgtcctctctcttcaacgcctttatcctgcaaaatgttaccggt
gtcgccgagagtgcggacattcccaagttcctcatcgagtccgtgaccaacgttctcgat
cgcctcgacgccgacgaaaacgacattgcccagtacgcgcccaacccgttcttcggctgg
aacccgaccaacgactcggccaaccacgagtccgaccagctgtccctcgtcgacggcgga
atggaccttcagaacatcccgctgcaccccctgatccagcccttccgcgccgtcgacgtc
atcttcgccgtcgactcctcggccgacacgactttcaactggcccaacggcaccgccctc
cgcgcgacctatgaccgcgccggcaccgccatcggcaacggcaccctcttcccgcccgtg
ccggatgccgagacgttcgtcaaccagcgtctcaaccagcgccccaccttcttcggatgc
gacgcgaacaactttaccctcgaggacggtcagtccttgccgccgctcatcgtctacgtc
cccaacgcgccctacaccgctcacagcaacgtctcgaccttcaacccgtcctacccgacc
gcccagcgcgacgccatcatccgcaacggcttcaacgccgccacgcagggcaatgctacg
gtcgacagcgagtggcccgtttgtgttgcctgcgccgtcctcagcaggagcctgcaccgc
ggcaacgagactgtgccagaagcgtgcacgcgctgtttcgagcggtactgctgggacgga
tcgaccgattcggcgagcgtcagctccttcgagccaggcttcattatcgggtccgatgaa
aaggaggatgctgctggcattgtgcgcgcaagcttctggggcgtgggtgtgagcttggct
gttgcggcgctggtgatgtggtaa

DBGET integrated database retrieval system