KEGG   Verticillium alfalfae: VDBG_07440Help
Entry
VDBG_07440        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_07440
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_07440
Transcription machinery [BR:val03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     VDBG_07440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MSAQPNTPLSPKTARVKSPAPGMPIFGCEHVQMLLSQSQDTTNQSVHHYKMILRNIFEQT
PLVPQTSKNNDGQPVTSLTANYLCLQCSSIVSEEERLKHGNKKQHRFYVDSRSGTLYCQI
CDDLVWDPTLEDLRVRKMGTGTFSTLLPDRKRKHDELFAESLKDNPLYISTNTTIASCKA
NGLRGIYNAGATCYQNVVLQSFLHNPLLRNFYLSDGHQSTDCSLSNCLSCAMDDMFQDFY
AVENTNGFTAASILSGFWISEKKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKPPEIG
SEHSCNCIIHQTFYGKLQSTTTCQNCGGVTNAVQSFLDLSLGLDNLAQRRARKTGQKQPS
LTLQECLDEEYVKSDKCEYRCHNCDSTQQARRNTSIKRLPNVLAIQLKRFEFKQGRHDRA
PSKIDTTVNFPLQLNMLPYTNRAKGSDTKESFELARSCTYDLLSVVVHVGEIDTGHYVSY
CRVADQWFKFNDHKVEMASKSDVLSAQPYLLFYIIRSLS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccagccaaatactcctctgtctcctaagacagccagggtcaagtcgccggcc
cctgggatgcccatctttggttgcgaacacgtccagatgctgctgtcccagtcacaggac
acaacgaaccagtctgttcaccactacaagatgattctccgtaatatctttgaacaaact
cccctggttccacagacgtccaagaacaatgatggtcagcctgtaacgtcgctcacggcc
aactacctatgcttgcaatgttcgagtattgtttcggaggaagagcgtctcaaacacgga
aacaaaaagcagcatcgcttttatgttgactctagaagcgggacactttactgtcagatt
tgtgatgacttggtctgggatcccactttagaagacctgagagttagaaaaatgggcact
ggcacgttctctacgcttctgccagatcgcaagaggaaacacgacgagctattcgcggaa
agcctaaaggacaaccctctctacatcagcacaaacaccacaatcgcctcatgtaaggca
aacggccttcgtggaatttataatgctggtgctacatgctatcagaacgtcgtattacag
agcttcctccacaacccgctgcttcgaaacttctatcttagcgatggccatcaaagcact
gattgtagcttgagcaattgcctcagttgcgccatggacgacatgtttcaggatttttac
gccgtggagaacacgaacggctttaccgctgccagtattttgtccggcttttggatatct
gagaagaaagcgttcgaaaatctcgtgaccaccaaggagcaggatgctcacgaattcttc
cagtttcttgcagaagagcttcacgaacgtaatggtgacggcaagccacccgagatcggg
agcgagcatagttgcaactgtatcatccatcaaactttctacggcaaacttcagagcacc
acgacttgtcagaattgtggcggggtcactaatgctgtacaatcctttctcgacctcagc
ttgggtctcgacaaccttgcgcagcgacgagctaggaagacgggacagaagcaaccaagt
cttacccttcaagagtgtctcgatgaggagtacgtgaaatcagacaagtgtgagtatcgc
tgccacaactgtgactccacacaacaggcaaggcgaaacacgagcatcaaacggcttccc
aatgtgcttgccatccagctcaagcgattcgagttcaagcaaggacgccacgacagggct
ccgtccaagattgacacgacagtcaattttcccttgcagctgaacatgctcccctatacc
aacagagccaagggaagtgatacaaaggaatcctttgagctggcgaggtcatgcacgtat
gatctcctcagcgttgttgttcacgttggcgaaatagatacgggtcactatgtttcttat
tgccgagttgccgatcagtggttcaaattcaatgaccacaaggttgagatggcctcaaag
tctgacgttctcagtgcacaaccatacttgctgttttacatcatcagatccctttcctga

DBGET integrated database retrieval system