KEGG   Verticillium albo-atrum: VDBG_07440Help
Entry
VDBG_07440        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MSAQPNTPLSPKTARVKSPAPGMPIFGCEHVQMLLSQSQDTTNQSVHHYKMILRNIFEQT
PLVPQTSKNNDGQPVTSLTANYLCLQCSSIVSEEERLKHGNKKQHRFYVDSRSGTLYCQI
CDDLVWDPTLEDLRVRKMGTGTFSTLLPDRKRKHDELFAESLKDNPLYISTNTTIASCKA
NGLRGIYNAGATCYQNVVLQSFLHNPLLRNFYLSDGHQSTDCSLSNCLSCAMDDMFQDFY
AVENTNGFTAASILSGFWISEKKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKPPEIG
SEHSCNCIIHQTFYGKLQSTTTCQNCGGVTNAVQSFLDLSLGLDNLAQRRARKTGQKQPS
LTLQECLDEEYVKSDKCEYRCHNCDSTQQARRNTSIKRLPNVLAIQLKRFEFKQGRHDRA
PSKIDTTVNFPLQLNMLPYTNRAKGSDTKESFELARSCTYDLLSVVVHVGEIDTGHYVSY
CRVADQWFKFNDHKVEMASKSDVLSAQPYLLFYIIRSLS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccagccaaatactcctctgtctcctaagacagccagggtcaagtcgccggcc
cctgggatgcccatctttggttgcgaacacgtccagatgctgctgtcccagtcacaggac
acaacgaaccagtctgttcaccactacaagatgattctccgtaatatctttgaacaaact
cccctggttccacagacgtccaagaacaatgatggtcagcctgtaacgtcgctcacggcc
aactacctatgcttgcaatgttcgagtattgtttcggaggaagagcgtctcaaacacgga
aacaaaaagcagcatcgcttttatgttgactctagaagcgggacactttactgtcagatt
tgtgatgacttggtctgggatcccactttagaagacctgagagttagaaaaatgggcact
ggcacgttctctacgcttctgccagatcgcaagaggaaacacgacgagctattcgcggaa
agcctaaaggacaaccctctctacatcagcacaaacaccacaatcgcctcatgtaaggca
aacggccttcgtggaatttataatgctggtgctacatgctatcagaacgtcgtattacag
agcttcctccacaacccgctgcttcgaaacttctatcttagcgatggccatcaaagcact
gattgtagcttgagcaattgcctcagttgcgccatggacgacatgtttcaggatttttac
gccgtggagaacacgaacggctttaccgctgccagtattttgtccggcttttggatatct
gagaagaaagcgttcgaaaatctcgtgaccaccaaggagcaggatgctcacgaattcttc
cagtttcttgcagaagagcttcacgaacgtaatggtgacggcaagccacccgagatcggg
agcgagcatagttgcaactgtatcatccatcaaactttctacggcaaacttcagagcacc
acgacttgtcagaattgtggcggggtcactaatgctgtacaatcctttctcgacctcagc
ttgggtctcgacaaccttgcgcagcgacgagctaggaagacgggacagaagcaaccaagt
cttacccttcaagagtgtctcgatgaggagtacgtgaaatcagacaagtgtgagtatcgc
tgccacaactgtgactccacacaacaggcaaggcgaaacacgagcatcaaacggcttccc
aatgtgcttgccatccagctcaagcgattcgagttcaagcaaggacgccacgacagggct
ccgtccaagattgacacgacagtcaattttcccttgcagctgaacatgctcccctatacc
aacagagccaagggaagtgatacaaaggaatcctttgagctggcgaggtcatgcacgtat
gatctcctcagcgttgttgttcacgttggcgaaatagatacgggtcactatgtttcttat
tgccgagttgccgatcagtggttcaaattcaatgaccacaaggttgagatggcctcaaag
tctgacgttctcagtgcacaaccatacttgctgttttacatcatcagatccctttcctga

DBGET integrated database retrieval system