KEGG   Verticillium alfalfae: VDBG_07511Help
Entry
VDBG_07511        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_07511
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_07511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1063 aa AA seqDB search
MSLQPSSEGGRTAPRWIYDLLSGLIHEVENSVKLSVDERLAYLQPELFSHSHDFKVFPEQ
SNIEGANPTILSLLCRGCDHHIVVKVVYDESRAQGLCNAGVAHYTGSLDCPPEAEDLAHH
LVHESTWSSKECEQLADPHRSPLVGRTQYKCSGASCSLQVTVETYLPRLNLEWLKALQDM
NVSFGEELWPLFNALGFVEQTLDNDGADEDYFVPEPLEPPNPPTQIGTLRSFVEDMRFEV
ENRIIALGQQGPASPHHDSAVDRLEKALHCFNWPQNKSFHVQSINPRDAEFSLLGVLPNF
DKSLTLFAYYRQCLIWPANRKLLTDALANNAKRLGDDELMLQATVEESKIDHPGAAVIAN
GDNDDTAMIWQAASFFGLDNIQAVGDHVIVSKFKEKVQNDPGQEGLAKEFLLVLGRSRKS
DRLIEAAQGPMSLNTAFVWLEANEQYDDEFIETMASTKIKSHPGNQYIKDECLEALDTIS
RNRKSDRLAAFAQELMLSQDDQLTAAQALVVRYDLPVGLKNIGNTCYLNSILQYLYTVKP
VRDLVLNFDDHKLDLSDESIAARRIGSNRMPLTRPDAVVSFACAEELWKLFNSLYPSDQV
AVKPAQRLANAALFLVQEVAEGASKDQGSSQSKSLPDVMGNIDIVIVSVDAVSDAASTGS
SKTLIGDAMEIDVNSDKVGGPLEGEVLPSIEGDAGHLQSNQDTAVAVADSDDPMNDARVL
AALETQKRSSGTEQQDVGEVLGRLLDRVQGAIKHTRVTEDGMQLDLIMDIFYISIKTRNQ
KDGQEPQVQVTFDRYVSAFPSQSGPCDINDALSRNFDLEYVEDSGYTRYSGIDCSVKPPT
ILQVMIQRTSSNGTKNGNPVIVSEDLYLDRFVDAVPGSRLYEYRSASWTLQKRILQLGEL
PAAPKVDNSDLLGHFIRRGLDTPPTETLSDAPEEPGRVVKHALLSPPSPPKLAKKLRQVR
SHCTTEHRFRCTAVDHRTFLSWVYHISQGLLFDRIDAVEHNLLILKALSLRRRPGLIGSG
ALFRHHWHLLFRTRAEMAYWVAYTVMQAADQTLSRQLYQPFQR
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagccttcctctgagggcggccgaacagcccctcgatggatctacgatctc
ctttccggcctcatacacgaagtcgagaattctgtgaaattgtccgtggacgaacgtctt
gcttacctccaacctgaactgttctctcattcgcacgacttcaaggtcttcccagagcag
agcaacatcgagggcgcgaacccgactatcttgtcgcttctgtgtcgaggctgcgatcac
cacatcgttgtcaaggtcgtctacgatgagtcccgcgctcaaggcctttgcaatgctgga
gttgcccactacactggtagcctcgactgtccacccgaggccgaggacctggcgcaccat
ctcgttcacgagagcacttggtcatccaaggaatgcgagcagctggctgacccccatcgg
tctcccctggtcggccggacacagtacaaatgttcgggcgcctcctgctccctacaagtg
accgtggaaacgtatctccctcgtctcaaccttgagtggctcaaggcacttcaagacatg
aatgtttccttcggcgaagaactctggcctctcttcaacgcactgggtttcgtggagcaa
acgcttgacaacgacggtgctgatgaggactatttcgttcctgagcctctcgaaccccct
aatccgcccacgcagattggaacgctacgctcgttcgtcgaagacatgcgcttcgaagtt
gagaaccgcatcatcgccctcggccagcaaggccctgcatcgccacaccatgactcagct
gtagaccggctagagaaagcgctccattgcttcaactggccgcagaacaagtctttccat
gtccagagcattaacccgcgcgatgctgaattctcgctcttgggagttcttcccaacttt
gacaagagcctgacgctctttgcgtactaccgccagtgcctgatatggcctgcgaaccgc
aagctcctcactgatgcactcgctaataatgcgaaacgcctgggagatgacgaactgatg
cttcaggcgactgtggaggaatcaaagatcgaccaccctggtgccgccgtgattgcaaac
ggtgacaacgatgacacagccatgatatggcaggccgcttcttttttcggccttgacaac
attcaagcagtgggcgaccatgtcattgtgagcaaattcaaggagaaggttcagaacgat
ccaggacaagaaggtctcgccaaagagttccttctggttctgggtcgttcgaggaagagt
gaccgcttgattgaggcggcgcaaggcccaatgtctctcaacaccgcttttgtgtggctc
gaagcgaatgaacagtatgacgacgagttcatcgagaccatggctagcaccaagatcaag
agccaccctggaaaccagtacatcaaggatgaatgccttgaagctctcgatacgatttcg
cggaacagaaagagcgaccgtctcgcggcatttgcccaggaactcatgctatcgcaagac
gaccagctcacagctgcccaagcgcttgtggtgcgctatgatctccccgtcggcctcaag
aacattggcaacacatgttacctgaacagcatcctgcaatatctctacactgtcaaaccg
gtgagagatctagtcctcaacttcgacgaccacaagttggacctcagcgatgagagcatc
gccgcacgtcgcattggtagcaaccgcatgccgctgacccgtcctgatgctgttgtatca
ttcgcatgcgccgaggagctgtggaagctgttcaacagcttgtacccaagcgaccaagtt
gccgtcaaacccgcacagcgcctggccaacgctgccctcttcctggtccaagaggttgcg
gagggtgcttcgaaggaccagggctctagccagtcgaagagtctacccgatgtcatgggc
aacatcgacattgtcatcgtatctgtggacgcggtctctgacgctgctagcaccggcagc
agcaagaccctgatcggcgatgctatggagattgatgtcaactcggacaaggtgggcggc
cccttggaaggagaggttctaccttccatcgagggcgatgctggacacttgcagagcaac
caagacactgccgtcgctgtggctgacagtgacgatcccatgaacgacgcacgggttctt
gctgctctcgagacgcagaagcgctcgtctggtactgaacaacaggatgtcggagaagtt
ttgggtcgcttgttggatagagtccagggcgccatcaagcacacccgtgttacggaagat
ggcatgcagctcgacctcatcatggatatcttctacatctcgatcaaaactcgcaaccag
aaagatgggcaagagcctcaagtccaagtaacgttcgaccgctacgttagcgcctttcct
tctcaaagcggaccgtgtgacatcaacgatgctctcagtcggaacttcgatctcgagtac
gtcgaagacagcggctacactcgatacagtggcattgattgctcggtcaagccgcccaca
atcttgcaagtgatgattcagcgcaccagcagcaatggcacgaagaatggcaatccggtg
atcgttagcgaggatctctatctggaccgcttcgttgacgccgtgcctgggtcgcgactt
tacgagtaccggagcgccagctggactctccagaagcggattctccagcttggcgagtta
cccgctgcgcccaaggttgacaacagcgacctcctcggccatttcattcgacgtggactc
gacacgcctccgacggagactctttcagacgcgcccgaggaacccggtcgagtcgtgaag
cacgcgctgctcagcccgccctcgcccccgaagctcgcgaagaagctccgacaggttcgg
tcgcactgcacaaccgagcaccgatttcgatgcaccgccgtcgatcatcgcacctttctc
tcgtgggtgtatcacatcagccagggcttactctttgataggattgatgctgtagagcac
aacctcctgatcctcaaagctttgagccttcgccgcaggcccggcctcatcggcagcggt
gcccttttccgacaccactggcacctactcttccgaactcgcgctgaaatggcctactgg
gtcgcgtacactgtcatgcaggctgccgatcagacgctctcgcgtcagctgtaccagcca
ttccagagatga

DBGET integrated database retrieval system