KEGG   Verticillium alfalfae: VDBG_07514Help
Entry
VDBG_07514        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VDBG_07514
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_07514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 475 aa AA seqDB search
MMQKILGIDRAGGGGGIMNTVSQAGQRGLTSMSGAMMAFKGDSESPPGLGNLDNSCYQNS
ILQGLASLKPLPRYLSEQLRDADLDRRRYDATATLRGLIADLNSVENNGRTLWTPSSLKN
MSTWQQQDAQEYFSKLLDEIDKEIAKAGMRKNSLPSLDASATATAAPTTASAPDDTNLSQ
HSDDSGYQSVSTLSRASSAAKLARNPLEGLVAQRVACVQCGHSDGLAMIPFNCLTLSLGL
NSAEHDLYELLDAYANIESIEGVECGKCTLLKVRKLLNILIERNPGTGSEMPRSRLAAVE
EAFENDDFEDKTITEKCKVSASHKVTSTKTKQTVIARPPQSLAIHMNRSAFDENTGHMWK
NGAAVRFPPTLDLGPWCLGSAGTYARVTPDEEAGTSGSSGRAPWSPVTRASPRSRVPCTS
CRPWSRILAGTRTATTFATASFRAPPRRRKSRRQRIWTPTTCRRRPVAAAWSSNP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaagattctcggcatagacagagctggcggcggcggcggcatcatgaacacc
gtctcgcaagccggccagcgtggcctcacctccatgtcgggcgccatgatggccttcaag
ggcgactcggagagcccgccgggcctcggcaacctcgacaactcgtgctaccagaacagc
atcctccaggggctcgcctcgctgaagcccctgccgcggtacctctccgagcagcttcgc
gacgccgacctcgaccgcaggcgctatgacgccaccgccacgctgcgtggcttgattgca
gacctcaacagcgtcgagaacaatgggcgaacgctgtggacgcccagttccctgaagaac
atgagcacctggcagcagcaggatgcgcaggaatacttctccaagctgctggacgagatt
gacaaggagattgccaaggccgggatgcgtaaaaacagcttgccgtcgctcgacgccagc
gcaacggccacagcggcacccaccacagccagcgccccggacgataccaatttgagccag
cacagcgacgacagcggctaccagagcgtttccaccctgtcgagggcaagctcggctgcc
aagctcgccaggaaccccctcgaaggcctcgtcgcgcagagggtcgcctgcgtgcagtgc
ggccactcggacggcctcgccatgatccccttcaactgtctgaccctcagcctgggcctc
aactcggccgagcacgacctctacgaactcctcgacgcgtacgccaacatcgaatccatc
gaaggtgtcgagtgcggcaagtgcacccttctcaaggtgcgcaagctcctcaacatcctc
atcgagcgtaaccccggaacgggcagcgagatgccccgatcccgcctcgccgccgttgag
gaggcgtttgagaatgacgacttcgaagacaagaccatcacggagaagtgcaaagtctcg
gcatcccacaaggtcacctcgaccaagacgaagcagaccgtcatcgcgcgcccgccgcag
agcctggcgatacacatgaaccgctccgcctttgacgagaacacgggtcacatgtggaag
aacggcgccgccgtccggtttccacccacgctggacctaggaccgtggtgcctcggcagc
gcggggacctacgcgcgcgtcacgccggacgaagaggccggcaccagtgggagcagtggc
cgtgctccatggtcgccggtgacaagggccagtccaagatcacgggtcccctgtacgagc
tgcaggccgtggtcacgcattttggcaggcacgagaacggccactacatttgctaccgca
agtttccgcgctcctccccgccgacgcaagtcgcgccgacaaaggatatggacgccgacg
acctgcaggcgacggccggtggcggcggcatggagctcaaacccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system