KEGG   Verticillium albo-atrum: VDBG_07514Help
Entry
VDBG_07514        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 475 aa AA seqDB search
MMQKILGIDRAGGGGGIMNTVSQAGQRGLTSMSGAMMAFKGDSESPPGLGNLDNSCYQNS
ILQGLASLKPLPRYLSEQLRDADLDRRRYDATATLRGLIADLNSVENNGRTLWTPSSLKN
MSTWQQQDAQEYFSKLLDEIDKEIAKAGMRKNSLPSLDASATATAAPTTASAPDDTNLSQ
HSDDSGYQSVSTLSRASSAAKLARNPLEGLVAQRVACVQCGHSDGLAMIPFNCLTLSLGL
NSAEHDLYELLDAYANIESIEGVECGKCTLLKVRKLLNILIERNPGTGSEMPRSRLAAVE
EAFENDDFEDKTITEKCKVSASHKVTSTKTKQTVIARPPQSLAIHMNRSAFDENTGHMWK
NGAAVRFPPTLDLGPWCLGSAGTYARVTPDEEAGTSGSSGRAPWSPVTRASPRSRVPCTS
CRPWSRILAGTRTATTFATASFRAPPRRRKSRRQRIWTPTTCRRRPVAAAWSSNP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaagattctcggcatagacagagctggcggcggcggcggcatcatgaacacc
gtctcgcaagccggccagcgtggcctcacctccatgtcgggcgccatgatggccttcaag
ggcgactcggagagcccgccgggcctcggcaacctcgacaactcgtgctaccagaacagc
atcctccaggggctcgcctcgctgaagcccctgccgcggtacctctccgagcagcttcgc
gacgccgacctcgaccgcaggcgctatgacgccaccgccacgctgcgtggcttgattgca
gacctcaacagcgtcgagaacaatgggcgaacgctgtggacgcccagttccctgaagaac
atgagcacctggcagcagcaggatgcgcaggaatacttctccaagctgctggacgagatt
gacaaggagattgccaaggccgggatgcgtaaaaacagcttgccgtcgctcgacgccagc
gcaacggccacagcggcacccaccacagccagcgccccggacgataccaatttgagccag
cacagcgacgacagcggctaccagagcgtttccaccctgtcgagggcaagctcggctgcc
aagctcgccaggaaccccctcgaaggcctcgtcgcgcagagggtcgcctgcgtgcagtgc
ggccactcggacggcctcgccatgatccccttcaactgtctgaccctcagcctgggcctc
aactcggccgagcacgacctctacgaactcctcgacgcgtacgccaacatcgaatccatc
gaaggtgtcgagtgcggcaagtgcacccttctcaaggtgcgcaagctcctcaacatcctc
atcgagcgtaaccccggaacgggcagcgagatgccccgatcccgcctcgccgccgttgag
gaggcgtttgagaatgacgacttcgaagacaagaccatcacggagaagtgcaaagtctcg
gcatcccacaaggtcacctcgaccaagacgaagcagaccgtcatcgcgcgcccgccgcag
agcctggcgatacacatgaaccgctccgcctttgacgagaacacgggtcacatgtggaag
aacggcgccgccgtccggtttccacccacgctggacctaggaccgtggtgcctcggcagc
gcggggacctacgcgcgcgtcacgccggacgaagaggccggcaccagtgggagcagtggc
cgtgctccatggtcgccggtgacaagggccagtccaagatcacgggtcccctgtacgagc
tgcaggccgtggtcacgcattttggcaggcacgagaacggccactacatttgctaccgca
agtttccgcgctcctccccgccgacgcaagtcgcgccgacaaaggatatggacgccgacg
acctgcaggcgacggccggtggcggcggcatggagctcaaacccctag

DBGET integrated database retrieval system