KEGG   Verticillium alfalfae: VDBG_07520Help
Entry
VDBG_07520        CDS       T02227                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
val  Verticillium alfalfae
Pathway
val00280  Valine, leucine and isoleucine degradation
val00410  beta-Alanine metabolism
val00640  Propanoate metabolism
val01100  Metabolic pathways
val01200  Carbon metabolism
Module
val_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VDBG_07520
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VDBG_07520
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VDBG_07520
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     VDBG_07520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 9537291
NCBI-ProteinID: XP_003002061
UniProt: C9SRJ5
AA seq 484 aa AA seqDB search
MPLRAKINNVGGARAQMSIRIRPEDFKPLSEDDPDDVVFNSAFGVRSIELNRPKKLNSLN
ASMIRKIVPRLSEWEKSDMVNVILMKGAGEKAFCAGGDVTALAQYNQEGPGGWKKSAAYF
ELEYKLNHYISTYTKPYVAIMDGITMGGGVGLSIHAPFRIATERTVFAMPETTIGFFPDV
GASFFLPRMNGGIGTYLALTSDRLKGVNAFYSGIATHYLDSTTLPLVEARLSELRFKDYD
SLAHRLAVINSTIEEYTTGLPYGEPILLAGELRRAIDRCFTKDSVPEILKALEAEEGATK
AWAQKTLETLHKRSPTAVHVTLRQMRVGRDWSIAKTFQREHQIAAQFMQHPDFTEGVSAL
LMSKGNPREPAWQPATLEQAAAAGGDVAEPFFRYDEGQALELLNDESFDEYPHEFGLPKE
DLIEAVIERGNLTPKEVVSHVAGTYNHRTGVAEVVEEFIDRAVTTNSKGIARIAGKKGAK
AAKA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgggccaagatcaacaatgtcggaggggcgcgagcacagatgtcgataaga
atcaggcccgaagacttcaagcccctctctgaagatgaccccgacgatgtcgtcttcaac
agcgcgttcggcgtccgctccatcgagctcaaccgccccaagaagctcaactccctgaac
gcctccatgatccgcaagattgtcccacgcttgagcgagtgggaaaagtccgacatggtc
aacgtcatcctcatgaagggagccggcgaaaaggccttctgcgccggcggcgacgtgacg
gccctcgcccagtacaaccaggagggacccggcggctggaagaagagcgccgcctacttt
gagctcgagtacaagctcaaccactacatctcgacatataccaagccctacgtcgccatc
atggacggcatcaccatgggcggcggcgttggcctcagcatccacgcccccttccgcatc
gccaccgagaggaccgtcttcgccatgcccgagacgaccattggcttcttccctgacgtc
ggcgcctccttcttcctgccgaggatgaacggcggcatcggcacctacctcgccctgacg
agcgaccgcctcaagggcgtcaacgccttctactcgggcatcgccacgcactacctcgac
tcgacgaccctgccgctcgtcgaggcccgcctcagcgagctgcgcttcaaggactacgac
tcgctggcccaccgcctcgccgtcatcaacagcaccattgaggagtacaccacgggcctg
ccctacggcgagcccatcctgctggccggcgagctgcgccgcgccatcgaccgctgcttc
accaaggacagcgtgcccgagattctcaaggccctcgaggccgaggagggcgccaccaag
gcctgggcgcagaagacgctcgagacgctgcacaagcgctccccgaccgccgtccacgtg
accctccgccagatgcgcgtcggccgcgactggtccatcgccaagacgttccagcgcgag
caccagatcgccgcgcagttcatgcagcaccccgacttcaccgagggcgtcagcgccctg
ctcatgagcaagggcaacccgcgcgagcctgcctggcagcccgccaccctcgagcaggcc
gccgccgccggcggagacgtcgccgagcccttcttccgctacgacgagggccaggcgctc
gagctgctcaacgacgagtcctttgacgagtacccccacgagtttggcctgcccaaggag
gacctcatcgaggccgtcatcgagcgcggcaacctgacacccaaggaggtcgtcagccac
gtcgccggcacgtacaaccaccgcaccggcgtcgctgaggtcgtcgaggagttcatcgac
agggccgtcacgacgaacagcaagggcatcgcgcgcatcgccggcaagaagggcgccaag
gcggccaaggcgtag

DBGET integrated database retrieval system