KEGG   Verticillium albo-atrum: VDBG_07611Help
Entry
VDBG_07611        CDS       T02227                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
val  Verticillium albo-atrum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:val01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:val01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:val00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:val00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:val00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 260 aa AA seqDB search
MAAVTPRRRLIGLSTKMYFSPSRTKEYLDVLLPRLATCPGPHAIDIFLIPDFLSLPAAVT
QTGTAPLLLGAQDCYAEDAGAYTGEVSPASLAELGVRIVELGHAERRRLFGETDASTAAK
AAAAARNGLIPLVCVGELDRPLAAGDEAGAQAAAEALRPQVESVLAALPPAAEVVLAYEP
VWAIGAAEPAAAEHVLGVVRAVRAMACVQGREGRVRILYGGSAGPGTFERLKGGVDGLFL
GRFGHDVDRFWRTVEEVASA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcactccccggcgccgcctcatcggcctctccaccaagatgtacttctcc
ccctcccgcacaaaagaatacctcgacgtactgctgccccgcctcgccacatgcccagga
ccccacgccatcgacattttcctgatccctgactttctctcgctgcccgccgccgtcacc
cagaccggcacagcccctctgctcctcggcgcccaggactgctacgccgaagacgcgggc
gcctacacgggcgaggtctcgcccgcctccctcgccgagctcggcgtccgcatcgtcgag
ctgggccacgccgagcgccgccgcctctttggcgagacggacgccagcaccgccgccaag
gctgccgccgccgcccgcaacggcctcatcccgctcgtgtgcgtcggcgagctcgaccgg
cccctggccgctggtgatgaggccggggcccaggccgccgccgaggcgctgcggccgcag
gtcgagagcgttctagcggccttgccgccagcggccgaggtcgtgctggcgtatgagccc
gtctgggccattggtgctgcggagccggcggctgctgagcatgtgcttggtgtcgtgcgg
gcggtgcgcgcgatggcgtgcgtgcagggccgggaggggcgtgtgaggattctgtatggg
ggcagcgcggggccggggacgttcgagaggttgaagggcggcgtggacgggctgttcctt
gggcggtttgggcatgatgtcgacaggttttggaggactgttgaggaggtggcgagtgcg
tga

DBGET integrated database retrieval system