KEGG   Verticillium albo-atrum: VDBG_07651Help
Entry
VDBG_07651        CDS       T02227                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
val  Verticillium albo-atrum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:val00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:val00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:val00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:val00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MARHSTIVVALALVGRAASRFDGLADTPPMGWHLLLSTSERVVSLGLRDLGYNTVVLDDC
WQDPAGRDAKGKVQPDLAKFPRGMKAISDALHAQNLKFGMYSSAGELTCARFAGSLDHER
DDADSFAAWGVDFLKYDNCFHMGRMGTPEISFNRFKAMSDALKASGRDIALNLCNWGEDY
VHTWGASLAHAWRMSDDIYDSFTRPDDLCSCASVADPFCVAPGTQCSVLFILNKVAPFAD
RAIPGGWNDLDMLEVGQGGMTDEEYKAHFALWAALKSPLMLGNDLRIMDSAALSIINNPA
IIALSQDPHGRAVYRVRRDVGPPRVPVADEYAAQEAHIWSGRLANGDQAVIFLNAAGADL
DMKASLAEIFVGDGPGGSAPHVRVGWSVHDLWAHRMPLETAEALIGASDDGVRADVLRAG
NWYNATEIPYAQGLANEDPRLFGEKIGEVQAGGVLEVKVFQTLCAGCFVSGASLSRAMGS
NQRPTRERTTRERMSCDRKGD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggcccgacactccaccatcgtcgtcgccctcgctcttgtcggccgagctgcatcacgg
tttgatggcttggccgataccccaccaatgggttggcacctgctgctcagtacctccgaa
cgggtcgtcagcctcggccttcgtgatcttggctacaacacggtcgtgctcgacgactgt
tggcaggatcctgccggcagagatgccaagggaaaggtccagcccgatctggccaagttc
cctcgcggcatgaaggccatttccgacgccctgcatgcccaaaatctcaaattcggcatg
tactccagtgcaggggaattgacctgcgctcgattcgcgggatcgctggatcacgagaga
gacgacgcggatagcttcgccgcctggggcgttgactttctcaagtatgacaattgcttc
catatgggtcgcatgggcacgccggaaatttcgttcaaccgcttcaaggccatgtctgat
gccttgaaggcgtcgggccgcgatatcgccttgaacctctgcaattggggagaggattac
gtgcacacgtggggcgcatctcttgcccatgcctggcgcatgtctgacgatatttacgac
tcctttacgcggcccgatgacctgtgcagctgcgcctcggttgccgaccccttctgcgtc
gcccccggcacgcagtgttccgtgctcttcatcctgaacaaggttgcgccctttgccgac
cgcgccatccccggtggctggaatgaccttgacatgctcgaggtaggacagggcggcatg
acggacgaggagtacaaggcccacttcgccttgtgggcggctctcaagtctccgctgatg
ctcggcaacgacctccgcatcatggactccgcggccctctccatcatcaacaaccccgcc
atcattgccttgagtcaggacccccacggccgcgctgtctaccgtgtccgccgagacgtc
ggccccccacgcgtccccgtcgcagacgagtatgctgcacaggaggcccacatatggagc
ggccgactcgccaacggcgaccaggccgtcattttcctcaacgccgccggcgccgatctt
gacatgaaggcctccctcgccgaaattttcgtcggcgatggaccgggcgggtcggcgccc
cacgtccgcgtcggttggtccgtacacgatctatgggcacaccgcatgcccctcgagacg
gccgaagctctcatcggggccagtgacgacggcgtccgtgccgatgtcctccgcgccgga
aattggtacaacgcgacggaaataccgtatgcccagggactggccaacgaagacccgcgg
ctgttcggcgagaagattggtgaggtacaagccggcggcgttcttgaggtcaaggttttt
caaacactctgcgcgggttgtttcgtctcaggcgcatcgctgtcgagggcgatgggttca
aatcaaaggcccacgcgcgagaggaccacgagggaaaggatgagctgtgatcgaaagggt
gactga

DBGET integrated database retrieval system